contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
776 | A | A Serial Killer | PROGRAMMING | 900 | [
"brute force",
"implementation",
"strings"
] | null | null | Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern. | First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=≤<=*n*<=≤<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters. | Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order. | [
"ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n",
"icm codeforces\n1\ncodeforces technex\n"
] | [
"ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n",
"icm codeforces\nicm technex\n"
] | In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears. | 500 | [
{
"input": "ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler",
"output": "ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler"
},
{
"input": "icm codeforces\n1\ncodeforces technex",
"output": "icm codeforces\nicm technex"
},
{
"input": "a b\n3\na c\nb d\nd e",
"output": "a b\nc b\nc d\nc e"
},
{
"input": "ze udggmyop\n4\nze szhrbmft\nudggmyop mjorab\nszhrbmft ojdtfnzxj\nojdtfnzxj yjlkg",
"output": "ze udggmyop\nszhrbmft udggmyop\nszhrbmft mjorab\nojdtfnzxj mjorab\nyjlkg mjorab"
},
{
"input": "q s\n10\nq b\nb j\ns g\nj f\nf m\ng c\nc a\nm d\nd z\nz o",
"output": "q s\nb s\nj s\nj g\nf g\nm g\nm c\nm a\nd a\nz a\no a"
},
{
"input": "iii iiiiii\n7\niii iiiiiiiiii\niiiiiiiiii iiii\niiii i\niiiiii iiiiiiii\niiiiiiii iiiiiiiii\ni iiiii\niiiii ii",
"output": "iii iiiiii\niiiiiiiiii iiiiii\niiii iiiiii\ni iiiiii\ni iiiiiiii\ni iiiiiiiii\niiiii iiiiiiiii\nii iiiiiiiii"
},
{
"input": "bwyplnjn zkms\n26\nzkms nzmcsytxh\nnzmcsytxh yujsb\nbwyplnjn gtbzhudpb\ngtbzhudpb hpk\nyujsb xvy\nhpk wrwnfokml\nwrwnfokml ndouuikw\nndouuikw ucgrja\nucgrja tgfmpldz\nxvy nycrfphn\nnycrfphn quvs\nquvs htdy\nhtdy k\ntgfmpldz xtdpkxm\nxtdpkxm suwqxs\nk fv\nsuwqxs qckllwy\nqckllwy diun\nfv lefa\nlefa gdoqjysx\ndiun dhpz\ngdoqjysx bdmqdyt\ndhpz dgz\ndgz v\nbdmqdyt aswy\naswy ydkayhlrnm",
"output": "bwyplnjn zkms\nbwyplnjn nzmcsytxh\nbwyplnjn yujsb\ngtbzhudpb yujsb\nhpk yujsb\nhpk xvy\nwrwnfokml xvy\nndouuikw xvy\nucgrja xvy\ntgfmpldz xvy\ntgfmpldz nycrfphn\ntgfmpldz quvs\ntgfmpldz htdy\ntgfmpldz k\nxtdpkxm k\nsuwqxs k\nsuwqxs fv\nqckllwy fv\ndiun fv\ndiun lefa\ndiun gdoqjysx\ndhpz gdoqjysx\ndhpz bdmqdyt\ndgz bdmqdyt\nv bdmqdyt\nv aswy\nv ydkayhlrnm"
},
{
"input": "wxz hbeqwqp\n7\nhbeqwqp cpieghnszh\ncpieghnszh tlqrpd\ntlqrpd ttwrtio\nttwrtio xapvds\nxapvds zk\nwxz yryk\nzk b",
"output": "wxz hbeqwqp\nwxz cpieghnszh\nwxz tlqrpd\nwxz ttwrtio\nwxz xapvds\nwxz zk\nyryk zk\nyryk b"
},
{
"input": "wced gnsgv\n23\ngnsgv japawpaf\njapawpaf nnvpeu\nnnvpeu a\na ddupputljq\nddupputljq qyhnvbh\nqyhnvbh pqwijl\nwced khuvs\nkhuvs bjkh\npqwijl ysacmboc\nbjkh srf\nsrf jknoz\njknoz hodf\nysacmboc xqtkoyh\nhodf rfp\nxqtkoyh bivgnwqvoe\nbivgnwqvoe nknf\nnknf wuig\nrfp e\ne bqqknq\nwuig sznhhhu\nbqqknq dhrtdld\ndhrtdld n\nsznhhhu bguylf",
"output": "wced gnsgv\nwced japawpaf\nwced nnvpeu\nwced a\nwced ddupputljq\nwced qyhnvbh\nwced pqwijl\nkhuvs pqwijl\nbjkh pqwijl\nbjkh ysacmboc\nsrf ysacmboc\njknoz ysacmboc\nhodf ysacmboc\nhodf xqtkoyh\nrfp xqtkoyh\nrfp bivgnwqvoe\nrfp nknf\nrfp wuig\ne wuig\nbqqknq wuig\nbqqknq sznhhhu\ndhrtdld sznhhhu\nn sznhhhu\nn bguylf"
},
{
"input": "qqqqqqqqqq qqqqqqqq\n3\nqqqqqqqq qqqqqqqqq\nqqqqqqqqq qqqqq\nqqqqq q",
"output": "qqqqqqqqqq qqqqqqqq\nqqqqqqqqqq qqqqqqqqq\nqqqqqqqqqq qqqqq\nqqqqqqqqqq q"
},
{
"input": "wwwww w\n8\nwwwww wwwwwwww\nwwwwwwww wwwwwwwww\nwwwwwwwww wwwwwwwwww\nw www\nwwwwwwwwww wwww\nwwww ww\nwww wwwwww\nwwwwww wwwwwww",
"output": "wwwww w\nwwwwwwww w\nwwwwwwwww w\nwwwwwwwwww w\nwwwwwwwwww www\nwwww www\nww www\nww wwwwww\nww wwwwwww"
},
{
"input": "k d\n17\nk l\nd v\nv z\nl r\nz i\nr s\ns p\np w\nw j\nj h\ni c\nh m\nm q\nc o\no g\nq x\nx n",
"output": "k d\nl d\nl v\nl z\nr z\nr i\ns i\np i\nw i\nj i\nh i\nh c\nm c\nq c\nq o\nq g\nx g\nn g"
}
] | 1,642,311,667 | 2,147,483,647 | Python 3 | OK | TESTS | 57 | 62 | 0 | initial = input().split()
n = int(input())
v= []
m = n
while m > 0:
s, t = input().split()
v.append([s, t])
m -= 1
ans= initial[0] + " " + initial[1]
for i in range(len(v)):
if initial[0] == v[i][0]:
initial[0] = v[i][1]
ans += "\n" + initial[0] + " " + initial[1]
elif initial[1] == v[i][0]:
initial[1] = v[i][1]
ans += "\n" + initial[0] + " " + initial[1]
print(ans) | Title: A Serial Killer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
Input Specification:
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=≤<=*n*<=≤<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
Output Specification:
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
Demo Input:
['ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n', 'icm codeforces\n1\ncodeforces technex\n']
Demo Output:
['ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n', 'icm codeforces\nicm technex\n']
Note:
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears. | ```python
initial = input().split()
n = int(input())
v= []
m = n
while m > 0:
s, t = input().split()
v.append([s, t])
m -= 1
ans= initial[0] + " " + initial[1]
for i in range(len(v)):
if initial[0] == v[i][0]:
initial[0] = v[i][1]
ans += "\n" + initial[0] + " " + initial[1]
elif initial[1] == v[i][0]:
initial[1] = v[i][1]
ans += "\n" + initial[0] + " " + initial[1]
print(ans)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question. | The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants | Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES"). | [
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] | [
"YES\n",
"NO\n"
] | In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | 0 | [
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,511,415,862 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | num1, num2, num3, num4, num5, num6 = input('Enter number: ').split()
num1=int(num1)
num2=int(num2)
num3=int(num3)
num4=int(num4)
num5=int(num5)
num6=int(num6)
if (num1+num2+num3) == (num4+num5+num6):
print('YES')
elif (num1+num2+num4) == (num3+num5+num6):
print('YES')
elif (num1+num2+num5) == (num3+num4+num6):
print('YES')
elif (num1+num2+num6) == (num3+num4+num5):
print('YES')
elif (num1+num3+num5) == (num2+num4+num6):
print('YES')
elif (num1+num3+num4) == (num2+num5+num6):
print('YES')
elif (num1+num3+num6) == (num2+num5+num4):
print('YES')
elif (num1+num5+num4) == (num3+num2+num6):
print('YES')
elif (num1+num6+num4) == (num3+num5+num2):
print('YES')
elif (num1+num5+num6) == (num3+num2+num4):
print('YES')
else:
print('NO') | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | ```python
num1, num2, num3, num4, num5, num6 = input('Enter number: ').split()
num1=int(num1)
num2=int(num2)
num3=int(num3)
num4=int(num4)
num5=int(num5)
num6=int(num6)
if (num1+num2+num3) == (num4+num5+num6):
print('YES')
elif (num1+num2+num4) == (num3+num5+num6):
print('YES')
elif (num1+num2+num5) == (num3+num4+num6):
print('YES')
elif (num1+num2+num6) == (num3+num4+num5):
print('YES')
elif (num1+num3+num5) == (num2+num4+num6):
print('YES')
elif (num1+num3+num4) == (num2+num5+num6):
print('YES')
elif (num1+num3+num6) == (num2+num5+num4):
print('YES')
elif (num1+num5+num4) == (num3+num2+num6):
print('YES')
elif (num1+num6+num4) == (num3+num5+num2):
print('YES')
elif (num1+num5+num6) == (num3+num2+num4):
print('YES')
else:
print('NO')
``` | 0 |
|
455 | A | Boredom | PROGRAMMING | 1,500 | [
"dp"
] | null | null | Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). | Print a single integer — the maximum number of points that Alex can earn. | [
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] | [
"2\n",
"4\n",
"10\n"
] | Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | 500 | [
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,698,588,015 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 30 | 0 | # Step 1
# Remove all elements that doesn't change anything. This also means that when we remove an element now other elements will disappear.
# Step 2
# Pick the one with the highest product and remove it
def FindBest(arr):
BestScore = float("-inf")
BestNumber = 0
for i in set(arr):
prod = i * arr.count(i)
if prod > BestScore:
BestScore = prod
BestNumber = i
return BestNumber
n = int(input())
arr = list(map(int, input().split()))
score = 0
Remove = []
for count, i in enumerate(arr, 0):
if i + 1 not in arr and i - 1 not in arr:
score += i
Remove.append(i)
arr = [i for i in arr if i not in Remove]
while arr:
Best = FindBest(arr)
score += Best
arr.remove(Best)
arr = [i for i in arr if i + 1 != Best and i - 1 != Best]
print(score) | Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print a single integer — the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | ```python
# Step 1
# Remove all elements that doesn't change anything. This also means that when we remove an element now other elements will disappear.
# Step 2
# Pick the one with the highest product and remove it
def FindBest(arr):
BestScore = float("-inf")
BestNumber = 0
for i in set(arr):
prod = i * arr.count(i)
if prod > BestScore:
BestScore = prod
BestNumber = i
return BestNumber
n = int(input())
arr = list(map(int, input().split()))
score = 0
Remove = []
for count, i in enumerate(arr, 0):
if i + 1 not in arr and i - 1 not in arr:
score += i
Remove.append(i)
arr = [i for i in arr if i not in Remove]
while arr:
Best = FindBest(arr)
score += Best
arr.remove(Best)
arr = [i for i in arr if i + 1 != Best and i - 1 != Best]
print(score)
``` | 0 |
|
148 | A | Insomnia cure | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation",
"math"
] | null | null | «One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons? | Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105). | Output the number of damaged dragons. | [
"1\n2\n3\n4\n12\n",
"2\n3\n4\n5\n24\n"
] | [
"12\n",
"17\n"
] | In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed. | 1,000 | [
{
"input": "1\n2\n3\n4\n12",
"output": "12"
},
{
"input": "2\n3\n4\n5\n24",
"output": "17"
},
{
"input": "1\n1\n1\n1\n100000",
"output": "100000"
},
{
"input": "10\n9\n8\n7\n6",
"output": "0"
},
{
"input": "8\n4\n4\n3\n65437",
"output": "32718"
},
{
"input": "8\n4\n1\n10\n59392",
"output": "59392"
},
{
"input": "4\n1\n8\n7\n44835",
"output": "44835"
},
{
"input": "6\n1\n7\n2\n62982",
"output": "62982"
},
{
"input": "2\n7\n4\n9\n56937",
"output": "35246"
},
{
"input": "2\n9\n8\n1\n75083",
"output": "75083"
},
{
"input": "8\n7\n7\n6\n69038",
"output": "24656"
},
{
"input": "4\n4\n2\n3\n54481",
"output": "36320"
},
{
"input": "6\n4\n9\n8\n72628",
"output": "28244"
},
{
"input": "9\n7\n8\n10\n42357",
"output": "16540"
},
{
"input": "5\n6\n4\n3\n60504",
"output": "36302"
},
{
"input": "7\n2\n3\n8\n21754",
"output": "15539"
},
{
"input": "1\n2\n10\n4\n39901",
"output": "39901"
},
{
"input": "3\n4\n7\n1\n58048",
"output": "58048"
},
{
"input": "9\n10\n4\n6\n52003",
"output": "21956"
},
{
"input": "5\n10\n9\n3\n70149",
"output": "32736"
},
{
"input": "5\n5\n5\n10\n55592",
"output": "11118"
},
{
"input": "1\n5\n2\n6\n49547",
"output": "49547"
},
{
"input": "3\n7\n7\n7\n84046",
"output": "36019"
},
{
"input": "10\n2\n1\n8\n63537",
"output": "63537"
},
{
"input": "7\n2\n10\n5\n81684",
"output": "53678"
},
{
"input": "7\n1\n6\n8\n99831",
"output": "99831"
},
{
"input": "3\n9\n3\n3\n61082",
"output": "20360"
},
{
"input": "5\n5\n8\n9\n79228",
"output": "29931"
},
{
"input": "1\n5\n5\n6\n89535",
"output": "89535"
},
{
"input": "5\n5\n2\n1\n7682",
"output": "7682"
},
{
"input": "7\n4\n8\n8\n25829",
"output": "9224"
},
{
"input": "3\n4\n3\n3\n87079",
"output": "43539"
},
{
"input": "5\n8\n4\n9\n5226",
"output": "2438"
},
{
"input": "4\n9\n6\n6\n1070",
"output": "415"
},
{
"input": "10\n10\n10\n10\n100000",
"output": "10000"
},
{
"input": "1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "10\n10\n10\n10\n1",
"output": "0"
},
{
"input": "10\n10\n1\n10\n10",
"output": "10"
},
{
"input": "10\n10\n1\n10\n100",
"output": "100"
},
{
"input": "2\n2\n2\n2\n1",
"output": "0"
}
] | 1,687,054,300 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 154 | 0 |
div = [ int(input()) for i in range(4) ]
num = int(input())
# div.sort()
s = 0
for i in range(1 , num+1):
is_div = False
for ele in div:
if i % ele == 0 :
is_div = True
# break
if is_div :
s += 1
print(s)
| Title: Insomnia cure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input Specification:
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output Specification:
Output the number of damaged dragons.
Demo Input:
['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n']
Demo Output:
['12\n', '17\n']
Note:
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed. | ```python
div = [ int(input()) for i in range(4) ]
num = int(input())
# div.sort()
s = 0
for i in range(1 , num+1):
is_div = False
for ele in div:
if i % ele == 0 :
is_div = True
# break
if is_div :
s += 1
print(s)
``` | 3 |
|
455 | A | Boredom | PROGRAMMING | 1,500 | [
"dp"
] | null | null | Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). | Print a single integer — the maximum number of points that Alex can earn. | [
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] | [
"2\n",
"4\n",
"10\n"
] | Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | 500 | [
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,670,582,837 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 8 | 1,000 | 307,200 | n = int(input())
mas = [int(x) for x in input().split(' ')]
a = [0] * 10 ** 5
for i in range(n):
a[mas[i]] += mas[i]
def func(n):
if n == 0:
return 0
elif n == 1:
return a[1]
return max(func(n - 1), func(n - 2) + a[n])
print(func(max(a)))
| Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print a single integer — the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | ```python
n = int(input())
mas = [int(x) for x in input().split(' ')]
a = [0] * 10 ** 5
for i in range(n):
a[mas[i]] += mas[i]
def func(n):
if n == 0:
return 0
elif n == 1:
return a[1]
return max(func(n - 1), func(n - 2) + a[n])
print(func(max(a)))
``` | 0 |
|
864 | D | Make a Permutation! | PROGRAMMING | 1,500 | [
"greedy",
"implementation",
"math"
] | null | null | Ivan has an array consisting of *n* elements. Each of the elements is an integer from 1 to *n*.
Recently Ivan learned about permutations and their lexicographical order. Now he wants to change (replace) minimum number of elements in his array in such a way that his array becomes a permutation (i.e. each of the integers from 1 to *n* was encountered in his array exactly once). If there are multiple ways to do it he wants to find the lexicographically minimal permutation among them.
Thus minimizing the number of changes has the first priority, lexicographical minimizing has the second priority.
In order to determine which of the two permutations is lexicographically smaller, we compare their first elements. If they are equal — compare the second, and so on. If we have two permutations *x* and *y*, then *x* is lexicographically smaller if *x**i*<=<<=*y**i*, where *i* is the first index in which the permutations *x* and *y* differ.
Determine the array Ivan will obtain after performing all the changes. | The first line contains an single integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of elements in Ivan's array.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the description of Ivan's array. | In the first line print *q* — the minimum number of elements that need to be changed in Ivan's array in order to make his array a permutation. In the second line, print the lexicographically minimal permutation which can be obtained from array with *q* changes. | [
"4\n3 2 2 3\n",
"6\n4 5 6 3 2 1\n",
"10\n6 8 4 6 7 1 6 3 4 5\n"
] | [
"2\n1 2 4 3 \n",
"0\n4 5 6 3 2 1 \n",
"3\n2 8 4 6 7 1 9 3 10 5 \n"
] | In the first example Ivan needs to replace number three in position 1 with number one, and number two in position 3 with number four. Then he will get a permutation [1, 2, 4, 3] with only two changed numbers — this permutation is lexicographically minimal among all suitable.
In the second example Ivan does not need to change anything because his array already is a permutation. | 2,000 | [
{
"input": "4\n3 2 2 3",
"output": "2\n1 2 4 3 "
},
{
"input": "6\n4 5 6 3 2 1",
"output": "0\n4 5 6 3 2 1 "
},
{
"input": "10\n6 8 4 6 7 1 6 3 4 5",
"output": "3\n2 8 4 6 7 1 9 3 10 5 "
},
{
"input": "6\n5 5 5 6 4 6",
"output": "3\n1 2 5 3 4 6 "
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 "
},
{
"input": "50\n1 1 2 1 1 1 1 1 1 1 1 1 2 1 2 1 1 2 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "48\n1 3 2 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 "
},
{
"input": "50\n2 4 1 2 3 7 2 2 1 1 3 4 2 12 4 3 2 1 2 5 1 3 3 7 9 6 10 5 7 1 4 3 6 2 3 12 1 3 2 6 2 2 2 4 1 6 1 3 7 13",
"output": "39\n2 4 1 8 3 7 11 14 15 16 17 18 19 12 20 21 22 23 24 5 25 26 27 28 9 6 10 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 13 "
},
{
"input": "50\n26 46 50 31 47 40 25 47 41 47 31 30 50 40 46 44 26 48 37 19 28 19 50 22 42 38 47 22 44 44 35 30 50 45 49 34 19 37 36 32 50 29 50 42 34 49 40 50 8 50",
"output": "25\n1 2 3 4 5 6 25 7 41 9 31 10 11 12 46 13 26 48 14 15 28 16 17 18 20 38 47 22 21 44 35 30 23 45 24 27 19 37 36 32 33 29 39 42 34 49 40 43 8 50 "
},
{
"input": "20\n15 18 20 6 19 13 20 17 20 16 19 17 17 19 16 12 14 19 20 20",
"output": "10\n15 18 1 6 2 13 3 4 5 7 8 9 17 10 16 12 14 19 11 20 "
},
{
"input": "50\n48 37 47 50 46 43 42 46 36 40 45 41 40 50 35 49 37 42 44 45 49 44 31 47 45 49 48 41 45 45 48 20 34 43 43 41 47 50 41 48 38 48 43 48 46 48 32 37 47 45",
"output": "31\n1 2 3 4 5 6 7 8 36 9 10 11 40 12 35 13 14 42 15 16 17 44 31 18 19 49 21 22 23 24 25 20 34 26 27 28 29 50 41 30 38 33 43 39 46 48 32 37 47 45 "
},
{
"input": "26\n26 26 23 25 22 26 26 24 26 26 25 18 25 22 24 24 24 24 24 26 26 25 24 26 26 23",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 18 12 22 13 14 15 16 17 19 20 25 24 21 26 23 "
},
{
"input": "50\n50 50 50 49 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 49 50 49 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 49",
"output": "48\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 50 49 "
},
{
"input": "50\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50",
"output": "49\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 "
},
{
"input": "50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "49\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 "
},
{
"input": "50\n18 42 38 38 38 50 50 38 49 49 38 38 42 18 49 49 49 49 18 50 18 38 38 49 49 50 49 42 38 49 42 38 38 49 38 49 50 49 49 49 18 49 18 38 42 50 42 49 18 49",
"output": "45\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 19 18 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 39 40 41 43 44 45 38 42 50 46 47 48 49 "
},
{
"input": "50\n4 50 27 48 32 32 37 33 18 24 38 6 32 17 1 46 36 16 10 9 9 25 26 40 28 2 1 5 15 50 2 4 18 39 42 46 25 3 10 42 37 23 28 41 33 45 25 11 13 18",
"output": "17\n4 7 27 48 8 12 14 19 18 24 38 6 32 17 1 20 36 16 10 9 21 22 26 40 28 2 29 5 15 50 30 31 34 39 35 46 25 3 43 42 37 23 44 41 33 45 47 11 13 49 "
},
{
"input": "50\n39 49 43 21 22 27 28 41 35 6 31 9 4 39 27 27 7 41 9 28 43 37 20 47 28 37 8 46 23 14 50 48 21 47 9 31 9 37 34 17 15 17 18 16 29 6 43 33 16 17",
"output": "20\n1 49 2 3 22 5 10 11 35 6 12 9 4 39 13 27 7 41 19 24 25 26 20 30 28 32 8 46 23 14 50 48 21 47 36 31 38 37 34 17 15 40 18 16 29 42 43 33 44 45 "
},
{
"input": "2\n1 2",
"output": "0\n1 2 "
},
{
"input": "2\n2 1",
"output": "0\n2 1 "
},
{
"input": "2\n1 1",
"output": "1\n1 2 "
},
{
"input": "2\n2 2",
"output": "1\n1 2 "
},
{
"input": "3\n1 1 1",
"output": "2\n1 2 3 "
},
{
"input": "3\n2 2 2",
"output": "2\n1 2 3 "
},
{
"input": "3\n3 3 3",
"output": "2\n1 2 3 "
},
{
"input": "3\n1 2 2",
"output": "1\n1 2 3 "
},
{
"input": "3\n2 1 3",
"output": "0\n2 1 3 "
},
{
"input": "3\n3 2 1",
"output": "0\n3 2 1 "
},
{
"input": "3\n2 2 3",
"output": "1\n1 2 3 "
},
{
"input": "3\n3 1 3",
"output": "1\n2 1 3 "
},
{
"input": "3\n2 2 1",
"output": "1\n2 3 1 "
},
{
"input": "3\n3 1 2",
"output": "0\n3 1 2 "
}
] | 1,676,315,497 | 3,997 | PyPy 3-64 | OK | TESTS | 46 | 233 | 29,286,400 | n=int(input())
arr=list(map(int,input().split()))
need=[]
s=set(el for el in arr)
for i in range(1,n+1):
if i not in s:
need.append(i)
need=need[::-1]
if not need:
print(0)
print(*arr)
else:
p=len(need)
tot=[0]*(n+1)
for i in range(n):
tot[arr[i]]+=1
used=[False]*(n+1)
for ind in range(n):
if tot[arr[ind]]==1 and used[arr[ind]]==False:
used[arr[ind]]=True
else:
if need[-1]<arr[ind]:
tot[arr[ind]]-=1
arr[ind]=need.pop()
used[arr[ind]]=True
elif used[arr[ind]]==False:
used[arr[ind]]=True
else:
tot[arr[ind]]-=1
arr[ind]=need.pop()
used[arr[ind]]=True
print(p)
print(*arr)
| Title: Make a Permutation!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan has an array consisting of *n* elements. Each of the elements is an integer from 1 to *n*.
Recently Ivan learned about permutations and their lexicographical order. Now he wants to change (replace) minimum number of elements in his array in such a way that his array becomes a permutation (i.e. each of the integers from 1 to *n* was encountered in his array exactly once). If there are multiple ways to do it he wants to find the lexicographically minimal permutation among them.
Thus minimizing the number of changes has the first priority, lexicographical minimizing has the second priority.
In order to determine which of the two permutations is lexicographically smaller, we compare their first elements. If they are equal — compare the second, and so on. If we have two permutations *x* and *y*, then *x* is lexicographically smaller if *x**i*<=<<=*y**i*, where *i* is the first index in which the permutations *x* and *y* differ.
Determine the array Ivan will obtain after performing all the changes.
Input Specification:
The first line contains an single integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of elements in Ivan's array.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the description of Ivan's array.
Output Specification:
In the first line print *q* — the minimum number of elements that need to be changed in Ivan's array in order to make his array a permutation. In the second line, print the lexicographically minimal permutation which can be obtained from array with *q* changes.
Demo Input:
['4\n3 2 2 3\n', '6\n4 5 6 3 2 1\n', '10\n6 8 4 6 7 1 6 3 4 5\n']
Demo Output:
['2\n1 2 4 3 \n', '0\n4 5 6 3 2 1 \n', '3\n2 8 4 6 7 1 9 3 10 5 \n']
Note:
In the first example Ivan needs to replace number three in position 1 with number one, and number two in position 3 with number four. Then he will get a permutation [1, 2, 4, 3] with only two changed numbers — this permutation is lexicographically minimal among all suitable.
In the second example Ivan does not need to change anything because his array already is a permutation. | ```python
n=int(input())
arr=list(map(int,input().split()))
need=[]
s=set(el for el in arr)
for i in range(1,n+1):
if i not in s:
need.append(i)
need=need[::-1]
if not need:
print(0)
print(*arr)
else:
p=len(need)
tot=[0]*(n+1)
for i in range(n):
tot[arr[i]]+=1
used=[False]*(n+1)
for ind in range(n):
if tot[arr[ind]]==1 and used[arr[ind]]==False:
used[arr[ind]]=True
else:
if need[-1]<arr[ind]:
tot[arr[ind]]-=1
arr[ind]=need.pop()
used[arr[ind]]=True
elif used[arr[ind]]==False:
used[arr[ind]]=True
else:
tot[arr[ind]]-=1
arr[ind]=need.pop()
used[arr[ind]]=True
print(p)
print(*arr)
``` | 3 |
|
527 | A | Playing with Paper | PROGRAMMING | 1,100 | [
"implementation",
"math"
] | null | null | One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson? | The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper. | Print a single integer — the number of ships that Vasya will make. | [
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] | [
"2\n",
"6\n",
"1000000000000\n"
] | Pictures to the first and second sample test. | 500 | [
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,667,583,398 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 22 | 2,000 | 0 | a,b=map(int,input().split())
f=True
s=0
while(f):
if a==b:
s+=1
f=False
elif b==1:
s+=a
f=False
else:
a=a-b
c=min([a,b])
d=max([a,b])
a=d
b=c
s+=1
print(s) | Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Output Specification:
Print a single integer — the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test. | ```python
a,b=map(int,input().split())
f=True
s=0
while(f):
if a==b:
s+=1
f=False
elif b==1:
s+=a
f=False
else:
a=a-b
c=min([a,b])
d=max([a,b])
a=d
b=c
s+=1
print(s)
``` | 0 |
|
557 | B | Pasha and Tea | PROGRAMMING | 1,500 | [
"constructive algorithms",
"implementation",
"math",
"sortings"
] | null | null | Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends. | The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters. | Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6. | [
"2 4\n1 1 1 1\n",
"3 18\n4 4 4 2 2 2\n",
"1 5\n2 3\n"
] | [
"3",
"18",
"4.5"
] | Pasha also has candies that he is going to give to girls but that is another task... | 1,000 | [
{
"input": "2 4\n1 1 1 1",
"output": "3.0000000000"
},
{
"input": "3 18\n4 4 4 2 2 2",
"output": "18.0000000000"
},
{
"input": "1 5\n2 3",
"output": "4.5000000000"
},
{
"input": "1 1\n1000000000 1000000000",
"output": "1.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 1 1 1 1",
"output": "6.0000000000"
},
{
"input": "4 1000000000\n1 1 1 1 2 2 2 2",
"output": "12.0000000000"
},
{
"input": "4 1\n3 3 3 3 4 4 4 4",
"output": "1.0000000000"
},
{
"input": "2 19\n3 3 5 5",
"output": "15.0000000000"
},
{
"input": "3 31\n3 3 3 5 5 5",
"output": "22.5000000000"
},
{
"input": "5 15\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "5 14\n2 3 4 1 2 4 5 3 5 10",
"output": "14.0000000000"
},
{
"input": "5 16\n2 3 4 1 2 4 5 3 5 10",
"output": "15.0000000000"
},
{
"input": "1 100\n1 200",
"output": "3.0000000000"
},
{
"input": "1 1\n1 1",
"output": "1.0000000000"
},
{
"input": "2 1000000000\n1 1 1 100",
"output": "3.0000000000"
},
{
"input": "4 30\n3 3 3 3 4 5 6 7",
"output": "24.0000000000"
},
{
"input": "2 100\n1 1 1 10",
"output": "3.0000000000"
},
{
"input": "3 18\n1 1 1 1 1 5",
"output": "4.5000000000"
}
] | 1,558,361,296 | 2,147,483,647 | Python 3 | OK | TESTS | 50 | 233 | 18,432,000 | s=list(map(int,input().split(' ')))
n=s[0]
w=s[1]
s=list(map(int,input().split(' ')))
s.sort()
c1=s[0]
c2=s[n]
tmp=round(w/(n*3),6)
if(c2/2>c1):
if(tmp>c1):
print(c1*3*n)
else:
print(w)
else:
if(tmp>c2/2):
print(3*n*c2/2)
else:
print(w) | Title: Pasha and Tea
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha decided to invite his friends to a tea party. For that occasion, he has a large teapot with the capacity of *w* milliliters and 2*n* tea cups, each cup is for one of Pasha's friends. The *i*-th cup can hold at most *a**i* milliliters of water.
It turned out that among Pasha's friends there are exactly *n* boys and exactly *n* girls and all of them are going to come to the tea party. To please everyone, Pasha decided to pour the water for the tea as follows:
- Pasha can boil the teapot exactly once by pouring there at most *w* milliliters of water; - Pasha pours the same amount of water to each girl; - Pasha pours the same amount of water to each boy; - if each girl gets *x* milliliters of water, then each boy gets 2*x* milliliters of water.
In the other words, each boy should get two times more water than each girl does.
Pasha is very kind and polite, so he wants to maximize the total amount of the water that he pours to his friends. Your task is to help him and determine the optimum distribution of cups between Pasha's friends.
Input Specification:
The first line of the input contains two integers, *n* and *w* (1<=≤<=*n*<=≤<=105, 1<=≤<=*w*<=≤<=109) — the number of Pasha's friends that are boys (equal to the number of Pasha's friends that are girls) and the capacity of Pasha's teapot in milliliters.
The second line of the input contains the sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=109, 1<=≤<=*i*<=≤<=2*n*) — the capacities of Pasha's tea cups in milliliters.
Output Specification:
Print a single real number — the maximum total amount of water in milliliters that Pasha can pour to his friends without violating the given conditions. Your answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=6.
Demo Input:
['2 4\n1 1 1 1\n', '3 18\n4 4 4 2 2 2\n', '1 5\n2 3\n']
Demo Output:
['3', '18', '4.5']
Note:
Pasha also has candies that he is going to give to girls but that is another task... | ```python
s=list(map(int,input().split(' ')))
n=s[0]
w=s[1]
s=list(map(int,input().split(' ')))
s.sort()
c1=s[0]
c2=s[n]
tmp=round(w/(n*3),6)
if(c2/2>c1):
if(tmp>c1):
print(c1*3*n)
else:
print(w)
else:
if(tmp>c2/2):
print(3*n*c2/2)
else:
print(w)
``` | 3 |
|
459 | B | Pashmak and Flowers | PROGRAMMING | 1,300 | [
"combinatorics",
"implementation",
"sortings"
] | null | null | Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way. | The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109). | The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively. | [
"2\n1 2\n",
"3\n1 4 5\n",
"5\n3 1 2 3 1\n"
] | [
"1 1",
"4 1",
"2 4"
] | In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | 500 | [
{
"input": "2\n1 2",
"output": "1 1"
},
{
"input": "3\n1 4 5",
"output": "4 1"
},
{
"input": "5\n3 1 2 3 1",
"output": "2 4"
},
{
"input": "2\n1 1",
"output": "0 1"
},
{
"input": "3\n1 1 1",
"output": "0 3"
},
{
"input": "4\n1 1 1 1",
"output": "0 6"
},
{
"input": "5\n1 1 1 1 1",
"output": "0 10"
},
{
"input": "5\n2 2 2 2 2",
"output": "0 10"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0 45"
},
{
"input": "3\n2 2 2",
"output": "0 3"
},
{
"input": "3\n3 3 3",
"output": "0 3"
},
{
"input": "2\n10000000 100000000",
"output": "90000000 1"
},
{
"input": "5\n5 5 5 5 5",
"output": "0 10"
},
{
"input": "5\n3 3 3 3 3",
"output": "0 10"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0 15"
},
{
"input": "2\n5 6",
"output": "1 1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0 45"
},
{
"input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0 45"
},
{
"input": "4\n4 4 4 4",
"output": "0 6"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0 21"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "0 55"
},
{
"input": "8\n8 8 8 8 8 8 8 8",
"output": "0 28"
},
{
"input": "2\n3 2",
"output": "1 1"
}
] | 1,695,257,376 | 2,147,483,647 | Python 3 | OK | TESTS | 58 | 187 | 28,672,000 | n=int(input())
flowers=sorted(list(map(int,input().split())))
if flowers[0]==flowers[-1]:
print(0)
print(n*(n-1)//2)
else:
difference=flowers[-1]-flowers[0]
cnt_min=len([x for x in flowers if x==flowers[0]])
cnt_max=len([x for x in flowers if x==flowers[-1]])
print(difference)
print(cnt_min*cnt_max) | Title: Pashmak and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109).
Output Specification:
The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively.
Demo Input:
['2\n1 2\n', '3\n1 4 5\n', '5\n3 1 2 3 1\n']
Demo Output:
['1 1', '4 1', '2 4']
Note:
In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers. | ```python
n=int(input())
flowers=sorted(list(map(int,input().split())))
if flowers[0]==flowers[-1]:
print(0)
print(n*(n-1)//2)
else:
difference=flowers[-1]-flowers[0]
cnt_min=len([x for x in flowers if x==flowers[0]])
cnt_max=len([x for x in flowers if x==flowers[-1]])
print(difference)
print(cnt_min*cnt_max)
``` | 3 |
|
75 | A | Life Without Zeros | PROGRAMMING | 1,000 | [
"implementation"
] | A. Life Without Zeros | 2 | 256 | Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation. | The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*. | The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise. | [
"101\n102\n",
"105\n106\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,639,969,486 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 60 | 0 | remove_0 = lambda x:int(x.replacremove_0('0',''))
a = input()
b = input()
if remove_0(a) + remove_0(b) != remove_0(a+b):
print('NO')
else:
print('YES') | Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
remove_0 = lambda x:int(x.replacremove_0('0',''))
a = input()
b = input()
if remove_0(a) + remove_0(b) != remove_0(a+b):
print('NO')
else:
print('YES')
``` | -1 |
190 | A | Vasya and the Bus | PROGRAMMING | 1,100 | [
"greedy",
"math"
] | null | null | One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..."
The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride.
The bus fare equals one berland ruble in High Bertown. However, not everything is that easy — no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=><=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble.
We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups.
Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total. | The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=105) — the number of the grown-ups and the number of the children in the bus, correspondingly. | If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers — the minimum and the maximum possible total bus fare, correspondingly.
Otherwise, print "Impossible" (without the quotes). | [
"1 2\n",
"0 5\n",
"2 2\n"
] | [
"2 2",
"Impossible",
"2 3"
] | In the first sample a grown-up rides with two children and pays two rubles.
In the second sample there are only children in the bus, so the situation is impossible.
In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total. | 500 | [
{
"input": "1 2",
"output": "2 2"
},
{
"input": "0 5",
"output": "Impossible"
},
{
"input": "2 2",
"output": "2 3"
},
{
"input": "2 7",
"output": "7 8"
},
{
"input": "4 10",
"output": "10 13"
},
{
"input": "6 0",
"output": "6 6"
},
{
"input": "7 1",
"output": "7 7"
},
{
"input": "0 0",
"output": "0 0"
},
{
"input": "71 24",
"output": "71 94"
},
{
"input": "16 70",
"output": "70 85"
},
{
"input": "0 1",
"output": "Impossible"
},
{
"input": "1 0",
"output": "1 1"
},
{
"input": "1 1",
"output": "1 1"
},
{
"input": "63 82",
"output": "82 144"
},
{
"input": "8 26",
"output": "26 33"
},
{
"input": "21 27",
"output": "27 47"
},
{
"input": "0 38",
"output": "Impossible"
},
{
"input": "46 84",
"output": "84 129"
},
{
"input": "59 96",
"output": "96 154"
},
{
"input": "63028 0",
"output": "63028 63028"
},
{
"input": "9458 0",
"output": "9458 9458"
},
{
"input": "80236 0",
"output": "80236 80236"
},
{
"input": "26666 0",
"output": "26666 26666"
},
{
"input": "59617 0",
"output": "59617 59617"
},
{
"input": "0 6048",
"output": "Impossible"
},
{
"input": "63028 28217",
"output": "63028 91244"
},
{
"input": "9458 39163",
"output": "39163 48620"
},
{
"input": "80236 14868",
"output": "80236 95103"
},
{
"input": "26666 52747",
"output": "52747 79412"
},
{
"input": "59617 28452",
"output": "59617 88068"
},
{
"input": "6048 4158",
"output": "6048 10205"
},
{
"input": "76826 4210",
"output": "76826 81035"
},
{
"input": "23256 15156",
"output": "23256 38411"
},
{
"input": "56207 53035",
"output": "56207 109241"
},
{
"input": "2637 28740",
"output": "28740 31376"
},
{
"input": "73415 4445",
"output": "73415 77859"
},
{
"input": "82019 4498",
"output": "82019 86516"
},
{
"input": "28449 80204",
"output": "80204 108652"
},
{
"input": "99227 53323",
"output": "99227 152549"
},
{
"input": "45657 29028",
"output": "45657 74684"
},
{
"input": "78608 4733",
"output": "78608 83340"
},
{
"input": "25038 4786",
"output": "25038 29823"
},
{
"input": "95816 80492",
"output": "95816 176307"
},
{
"input": "42246 94024",
"output": "94024 136269"
},
{
"input": "0 100000",
"output": "Impossible"
},
{
"input": "100000 0",
"output": "100000 100000"
},
{
"input": "1 100000",
"output": "100000 100000"
},
{
"input": "100000 1",
"output": "100000 100000"
},
{
"input": "63028 63028",
"output": "63028 126055"
},
{
"input": "9458 9458",
"output": "9458 18915"
},
{
"input": "80236 80236",
"output": "80236 160471"
},
{
"input": "26666 26666",
"output": "26666 53331"
},
{
"input": "59617 59617",
"output": "59617 119233"
},
{
"input": "100000 100000",
"output": "100000 199999"
}
] | 1,600,756,866 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 186 | 0 | n,m=map(int,input().split())
if n==0:
print('Impossible')
elif m<=n:
print(n,end=' ')
print(m+n-1)
elif m>n:
print(m,end=' ')
print(m+n-1) | Title: Vasya and the Bus
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..."
The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride.
The bus fare equals one berland ruble in High Bertown. However, not everything is that easy — no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=><=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble.
We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups.
Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total.
Input Specification:
The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=105) — the number of the grown-ups and the number of the children in the bus, correspondingly.
Output Specification:
If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers — the minimum and the maximum possible total bus fare, correspondingly.
Otherwise, print "Impossible" (without the quotes).
Demo Input:
['1 2\n', '0 5\n', '2 2\n']
Demo Output:
['2 2', 'Impossible', '2 3']
Note:
In the first sample a grown-up rides with two children and pays two rubles.
In the second sample there are only children in the bus, so the situation is impossible.
In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total. | ```python
n,m=map(int,input().split())
if n==0:
print('Impossible')
elif m<=n:
print(n,end=' ')
print(m+n-1)
elif m>n:
print(m,end=' ')
print(m+n-1)
``` | 0 |
|
581 | A | Vasya the Hipster | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him? | The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. | Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. | [
"3 1\n",
"2 3\n",
"7 3\n"
] | [
"1 1\n",
"2 0\n",
"3 2\n"
] | In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | 500 | [
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,670,692,431 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | import sys
# sys.stdin = open("input.txt", "r")
# sys.stdout = open("output.txt", "w")
def solve(n, k):
ans = 0
if n > k:
ans += k
ans += (n - k) // 2
else:
ans += n
ans += (k - n) // 2
return ans
def main():
n, k = map(int, sys.stdin.readline().split())
print(solve(n, k))
if __name__ == "__main__":
main()
# трамвай - 1
# n = 30
| Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | ```python
import sys
# sys.stdin = open("input.txt", "r")
# sys.stdout = open("output.txt", "w")
def solve(n, k):
ans = 0
if n > k:
ans += k
ans += (n - k) // 2
else:
ans += n
ans += (k - n) // 2
return ans
def main():
n, k = map(int, sys.stdin.readline().split())
print(solve(n, k))
if __name__ == "__main__":
main()
# трамвай - 1
# n = 30
``` | 0 |
|
82 | A | Double Cola | PROGRAMMING | 1,100 | [
"implementation",
"math"
] | A. Double Cola | 1 | 256 | Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon. | The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers. | Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially. | [
"1\n",
"6\n",
"1802\n"
] | [
"Sheldon\n",
"Sheldon\n",
"Penny\n"
] | none | 500 | [
{
"input": "1",
"output": "Sheldon"
},
{
"input": "6",
"output": "Sheldon"
},
{
"input": "1802",
"output": "Penny"
},
{
"input": "1",
"output": "Sheldon"
},
{
"input": "2",
"output": "Leonard"
},
{
"input": "3",
"output": "Penny"
},
{
"input": "4",
"output": "Rajesh"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "10",
"output": "Penny"
},
{
"input": "534",
"output": "Rajesh"
},
{
"input": "5033",
"output": "Howard"
},
{
"input": "10010",
"output": "Howard"
},
{
"input": "500000000",
"output": "Penny"
},
{
"input": "63",
"output": "Rajesh"
},
{
"input": "841",
"output": "Leonard"
},
{
"input": "3667",
"output": "Penny"
},
{
"input": "38614",
"output": "Howard"
},
{
"input": "282798",
"output": "Rajesh"
},
{
"input": "9266286",
"output": "Rajesh"
},
{
"input": "27385966",
"output": "Leonard"
},
{
"input": "121580142",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
},
{
"input": "300",
"output": "Howard"
},
{
"input": "1745",
"output": "Leonard"
},
{
"input": "8302",
"output": "Rajesh"
},
{
"input": "184518",
"output": "Sheldon"
},
{
"input": "1154414",
"output": "Rajesh"
},
{
"input": "28643950",
"output": "Leonard"
},
{
"input": "159222638",
"output": "Howard"
},
{
"input": "24",
"output": "Penny"
},
{
"input": "505",
"output": "Penny"
},
{
"input": "4425",
"output": "Rajesh"
},
{
"input": "12079",
"output": "Sheldon"
},
{
"input": "469726",
"output": "Penny"
},
{
"input": "3961838",
"output": "Penny"
},
{
"input": "57710446",
"output": "Leonard"
},
{
"input": "80719470",
"output": "Howard"
},
{
"input": "1000000000",
"output": "Penny"
},
{
"input": "999999999",
"output": "Penny"
},
{
"input": "999999998",
"output": "Penny"
},
{
"input": "5",
"output": "Howard"
}
] | 1,665,493,587 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | a=['Sheldon','Leonard','Penny','Rajesh','Howard']
n= input()
i= 1
while 5*2 ** i < n:
i+=1
array = [x for x in a for _ in range(2**i)]
print(a + array)[n-1])
| Title: Double Cola
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sheldon, Leonard, Penny, Rajesh and Howard are in the queue for a "Double Cola" drink vending machine; there are no other people in the queue. The first one in the queue (Sheldon) buys a can, drinks it and doubles! The resulting two Sheldons go to the end of the queue. Then the next in the queue (Leonard) buys a can, drinks it and gets to the end of the queue as two Leonards, and so on. This process continues ad infinitum.
For example, Penny drinks the third can of cola and the queue will look like this: Rajesh, Howard, Sheldon, Sheldon, Leonard, Leonard, Penny, Penny.
Write a program that will print the name of a man who will drink the *n*-th can.
Note that in the very beginning the queue looks like that: Sheldon, Leonard, Penny, Rajesh, Howard. The first person is Sheldon.
Input Specification:
The input data consist of a single integer *n* (1<=≤<=*n*<=≤<=109).
It is guaranteed that the pretests check the spelling of all the five names, that is, that they contain all the five possible answers.
Output Specification:
Print the single line — the name of the person who drinks the *n*-th can of cola. The cans are numbered starting from 1. Please note that you should spell the names like this: "Sheldon", "Leonard", "Penny", "Rajesh", "Howard" (without the quotes). In that order precisely the friends are in the queue initially.
Demo Input:
['1\n', '6\n', '1802\n']
Demo Output:
['Sheldon\n', 'Sheldon\n', 'Penny\n']
Note:
none | ```python
a=['Sheldon','Leonard','Penny','Rajesh','Howard']
n= input()
i= 1
while 5*2 ** i < n:
i+=1
array = [x for x in a for _ in range(2**i)]
print(a + array)[n-1])
``` | -1 |
261 | A | Maxim and Discounts | PROGRAMMING | 1,400 | [
"greedy",
"sortings"
] | null | null | Maxim always goes to the supermarket on Sundays. Today the supermarket has a special offer of discount systems.
There are *m* types of discounts. We assume that the discounts are indexed from 1 to *m*. To use the discount number *i*, the customer takes a special basket, where he puts exactly *q**i* items he buys. Under the terms of the discount system, in addition to the items in the cart the customer can receive at most two items from the supermarket for free. The number of the "free items" (0, 1 or 2) to give is selected by the customer. The only condition imposed on the selected "free items" is as follows: each of them mustn't be more expensive than the cheapest item out of the *q**i* items in the cart.
Maxim now needs to buy *n* items in the shop. Count the minimum sum of money that Maxim needs to buy them, if he use the discount system optimally well.
Please assume that the supermarket has enough carts for any actions. Maxim can use the same discount multiple times. Of course, Maxim can buy items without any discounts. | The first line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of discount types. The second line contains *m* integers: *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=105).
The third line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of items Maxim needs. The fourth line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — the items' prices.
The numbers in the lines are separated by single spaces. | In a single line print a single integer — the answer to the problem. | [
"1\n2\n4\n50 50 100 100\n",
"2\n2 3\n5\n50 50 50 50 50\n",
"1\n1\n7\n1 1 1 1 1 1 1\n"
] | [
"200\n",
"150\n",
"3\n"
] | In the first sample Maxim needs to buy two items that cost 100 and get a discount for two free items that cost 50. In that case, Maxim is going to pay 200.
In the second sample the best strategy for Maxim is to buy 3 items and get 2 items for free using the discount. In that case, Maxim is going to pay 150. | 500 | [
{
"input": "1\n2\n4\n50 50 100 100",
"output": "200"
},
{
"input": "2\n2 3\n5\n50 50 50 50 50",
"output": "150"
},
{
"input": "1\n1\n7\n1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "60\n7 4 20 15 17 6 2 2 3 18 13 14 16 11 13 12 6 10 14 1 16 6 4 9 10 8 10 15 16 13 13 9 16 11 5 4 11 1 20 5 11 20 19 9 14 13 10 6 6 9 2 13 11 4 1 6 8 18 10 3\n26\n2481 6519 9153 741 9008 6601 6117 1689 5911 2031 2538 5553 1358 6863 7521 4869 6276 5356 5305 6761 5689 7476 5833 257 2157 218",
"output": "44768"
},
{
"input": "88\n8 3 4 3 1 17 5 10 18 12 9 12 4 6 19 14 9 10 10 8 15 11 18 3 11 4 10 11 7 9 14 7 13 2 8 2 15 2 8 16 7 1 9 1 11 13 13 15 8 9 4 2 13 12 12 11 1 5 20 19 13 15 6 6 11 20 14 18 11 20 20 13 8 4 17 12 17 4 13 14 1 20 19 5 7 3 19 16\n33\n7137 685 2583 6751 2104 2596 2329 9948 7961 9545 1797 6507 9241 3844 5657 1887 225 7310 1165 6335 5729 5179 8166 9294 3281 8037 1063 6711 8103 7461 4226 2894 9085",
"output": "61832"
},
{
"input": "46\n11 6 8 8 11 8 2 8 17 3 16 1 9 12 18 2 2 5 17 19 3 9 8 19 2 4 2 15 2 11 13 13 8 6 10 12 7 7 17 15 10 19 7 7 19 6\n71\n6715 8201 9324 276 8441 2378 4829 9303 5721 3895 8193 7725 1246 8845 6863 2897 5001 5055 2745 596 9108 4313 1108 982 6483 7256 4313 8981 9026 9885 2433 2009 8441 7441 9044 6969 2065 6721 424 5478 9128 5921 11 6201 3681 4876 3369 6205 4865 8201 9751 371 2881 7995 641 5841 3595 6041 2403 1361 5121 3801 8031 7909 3809 7741 1026 9633 8711 1907 6363",
"output": "129008"
},
{
"input": "18\n16 16 20 12 13 10 14 15 4 5 6 8 4 11 12 11 16 7\n15\n371 2453 905 1366 6471 4331 4106 2570 4647 1648 7911 2147 1273 6437 3393",
"output": "38578"
},
{
"input": "2\n12 4\n28\n5366 5346 1951 3303 1613 5826 8035 7079 7633 6155 9811 9761 3207 4293 3551 5245 7891 4463 3981 2216 3881 1751 4495 96 671 1393 1339 4241",
"output": "89345"
},
{
"input": "57\n3 13 20 17 18 18 17 2 17 8 20 2 11 12 11 14 4 20 9 20 14 19 20 4 4 8 8 18 17 16 18 10 4 7 9 8 10 8 20 4 11 8 12 16 16 4 11 12 16 1 6 14 11 12 19 8 20\n7\n5267 7981 1697 826 6889 1949 2413",
"output": "11220"
},
{
"input": "48\n14 2 5 3 10 10 5 6 14 8 19 13 4 4 3 13 18 19 9 16 3 1 14 9 13 10 13 4 12 11 8 2 18 20 14 11 3 11 18 11 4 2 7 2 18 19 2 8\n70\n9497 5103 1001 2399 5701 4053 3557 8481 1736 4139 5829 1107 6461 4089 5936 7961 6017 1416 1191 4635 4288 5605 8857 1822 71 1435 2837 5523 6993 2404 2840 8251 765 5678 7834 8595 3091 7073 8673 2299 2685 7729 8017 3171 9155 431 3773 7927 671 4063 1123 5384 2721 7901 2315 5199 8081 7321 8196 2887 9384 56 7501 1931 4769 2055 7489 3681 6321 8489",
"output": "115395"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "1\n2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n3\n3 1 1",
"output": "3"
}
] | 1,623,242,837 | 2,147,483,647 | Python 3 | OK | TESTS | 45 | 404 | 9,216,000 | m=int(input())
lstm = list(map(int, input().strip().split(' ')))
n=int(input())
lstn = list(map(int, input().strip().split(' ')))
m1=min(lstm)
lstn.sort(reverse=True)
i=0
s=0
while(i<n):
if i+m1<=n:
s+=sum(lstn[i:i+m1])
i+=m1
if i+2<=n:
i+=2
elif i+1<=n:
i+=1
else:
s+=sum(lstn[i:n])
i=n
print(s) | Title: Maxim and Discounts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim always goes to the supermarket on Sundays. Today the supermarket has a special offer of discount systems.
There are *m* types of discounts. We assume that the discounts are indexed from 1 to *m*. To use the discount number *i*, the customer takes a special basket, where he puts exactly *q**i* items he buys. Under the terms of the discount system, in addition to the items in the cart the customer can receive at most two items from the supermarket for free. The number of the "free items" (0, 1 or 2) to give is selected by the customer. The only condition imposed on the selected "free items" is as follows: each of them mustn't be more expensive than the cheapest item out of the *q**i* items in the cart.
Maxim now needs to buy *n* items in the shop. Count the minimum sum of money that Maxim needs to buy them, if he use the discount system optimally well.
Please assume that the supermarket has enough carts for any actions. Maxim can use the same discount multiple times. Of course, Maxim can buy items without any discounts.
Input Specification:
The first line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of discount types. The second line contains *m* integers: *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=105).
The third line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of items Maxim needs. The fourth line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — the items' prices.
The numbers in the lines are separated by single spaces.
Output Specification:
In a single line print a single integer — the answer to the problem.
Demo Input:
['1\n2\n4\n50 50 100 100\n', '2\n2 3\n5\n50 50 50 50 50\n', '1\n1\n7\n1 1 1 1 1 1 1\n']
Demo Output:
['200\n', '150\n', '3\n']
Note:
In the first sample Maxim needs to buy two items that cost 100 and get a discount for two free items that cost 50. In that case, Maxim is going to pay 200.
In the second sample the best strategy for Maxim is to buy 3 items and get 2 items for free using the discount. In that case, Maxim is going to pay 150. | ```python
m=int(input())
lstm = list(map(int, input().strip().split(' ')))
n=int(input())
lstn = list(map(int, input().strip().split(' ')))
m1=min(lstm)
lstn.sort(reverse=True)
i=0
s=0
while(i<n):
if i+m1<=n:
s+=sum(lstn[i:i+m1])
i+=m1
if i+2<=n:
i+=2
elif i+1<=n:
i+=1
else:
s+=sum(lstn[i:n])
i=n
print(s)
``` | 3 |
|
897 | B | Chtholly's request | PROGRAMMING | 1,300 | [
"brute force"
] | null | null | — I experienced so many great things.
— You gave me memories like dreams... But I have to leave now...
— One last request, can you...
— Help me solve a Codeforces problem?
— ......
— What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help! | The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109). | Output single integer — answer to the problem. | [
"2 100\n",
"5 30\n"
] | [
"33\n",
"15\n"
] | In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 1,000 | [
{
"input": "2 100",
"output": "33"
},
{
"input": "5 30",
"output": "15"
},
{
"input": "42147 412393322",
"output": "251637727"
},
{
"input": "77809 868097296",
"output": "440411873"
},
{
"input": "5105 443422097",
"output": "363192634"
},
{
"input": "75615 376679484",
"output": "373089399"
},
{
"input": "22951 23793302",
"output": "1898631"
},
{
"input": "12785 993582106",
"output": "286204743"
},
{
"input": "60276 428978808",
"output": "376477293"
},
{
"input": "84776 104860385",
"output": "10209596"
},
{
"input": "41984 653766991",
"output": "17823101"
},
{
"input": "100000 1000000000",
"output": "495495496"
},
{
"input": "41163 472310076",
"output": "207304047"
},
{
"input": "6983 765352180",
"output": "586866999"
},
{
"input": "33493 967727004",
"output": "305705165"
},
{
"input": "90898 94010922",
"output": "65928728"
},
{
"input": "67298 349286579",
"output": "156435206"
},
{
"input": "92452 296773064",
"output": "229486976"
},
{
"input": "58832 563860457",
"output": "16775206"
},
{
"input": "90234 156145441",
"output": "44023160"
},
{
"input": "91454 977186148",
"output": "681779748"
},
{
"input": "11108 444095250",
"output": "188075844"
},
{
"input": "46304 584475527",
"output": "275627129"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 1000000000",
"output": "11"
},
{
"input": "100000 1",
"output": "0"
}
] | 1,512,268,110 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 171 | 9,318,400 | #code
n , m =map(int,input().split())
l = [str(x) for x in range(1,n+1)]
sum_ele = 0
for i in l:
i=i+i[::-1]
sum_ele = (sum_ele + int(i))%m
print(sum_ele)
| Title: Chtholly's request
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
— I experienced so many great things.
— You gave me memories like dreams... But I have to leave now...
— One last request, can you...
— Help me solve a Codeforces problem?
— ......
— What?
Chtholly has been thinking about a problem for days:
If a number is palindrome and length of its decimal representation without leading zeros is even, we call it a zcy number. A number is palindrome means when written in decimal representation, it contains no leading zeros and reads the same forwards and backwards. For example 12321 and 1221 are palindromes and 123 and 12451 are not. Moreover, 1221 is zcy number and 12321 is not.
Given integers *k* and *p*, calculate the sum of the *k* smallest zcy numbers and output this sum modulo *p*.
Unfortunately, Willem isn't good at solving this kind of problems, so he asks you for help!
Input Specification:
The first line contains two integers *k* and *p* (1<=≤<=*k*<=≤<=105,<=1<=≤<=*p*<=≤<=109).
Output Specification:
Output single integer — answer to the problem.
Demo Input:
['2 100\n', '5 30\n']
Demo Output:
['33\n', '15\n']
Note:
In the first example, the smallest zcy number is 11, and the second smallest zcy number is 22.
In the second example, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/68fffad54395f7d920ad0384e07c6215ddc64141.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
#code
n , m =map(int,input().split())
l = [str(x) for x in range(1,n+1)]
sum_ele = 0
for i in l:
i=i+i[::-1]
sum_ele = (sum_ele + int(i))%m
print(sum_ele)
``` | 3 |
|
454 | A | Little Pony and Crystal Mine | PROGRAMMING | 800 | [
"implementation"
] | null | null | Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw. | The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd). | Output a crystal of size *n*. | [
"3\n",
"5\n",
"7\n"
] | [
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] | none | 500 | [
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,617,958,643 | 2,147,483,647 | PyPy 3 | OK | TESTS | 12 | 92 | 0 | def romb(n):
final_list = []
m_l = []
for i in range(n):
m_l.append("*")
mid = len(m_l) // 2
reached_first = False
k = 0
for i in range(n):
if len(m_l) - 1 >= i + mid and not reached_first:
m_l[i + mid] = "D"
m_l[mid - i] = "D"
final_list.append("".join(m_l))
if len(m_l) - 1 < i + mid:
reached_first = True
if reached_first:
m_l[-1 - k] = "*"
m_l[0 + k] = "*"
k += 1
final_list.append("".join(m_l))
return "\n".join(final_list)
def main_function():
n = int(input())
return romb(n)
print(main_function()) | Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none | ```python
def romb(n):
final_list = []
m_l = []
for i in range(n):
m_l.append("*")
mid = len(m_l) // 2
reached_first = False
k = 0
for i in range(n):
if len(m_l) - 1 >= i + mid and not reached_first:
m_l[i + mid] = "D"
m_l[mid - i] = "D"
final_list.append("".join(m_l))
if len(m_l) - 1 < i + mid:
reached_first = True
if reached_first:
m_l[-1 - k] = "*"
m_l[0 + k] = "*"
k += 1
final_list.append("".join(m_l))
return "\n".join(final_list)
def main_function():
n = int(input())
return romb(n)
print(main_function())
``` | 3 |
|
264 | A | Escape from Stones | PROGRAMMING | 1,200 | [
"constructive algorithms",
"data structures",
"implementation",
"two pointers"
] | null | null | Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls. | The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r". | Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left. | [
"llrlr\n",
"rrlll\n",
"lrlrr\n"
] | [
"3\n5\n4\n2\n1\n",
"1\n2\n5\n4\n3\n",
"2\n4\n5\n3\n1\n"
] | In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1. | 500 | [
{
"input": "llrlr",
"output": "3\n5\n4\n2\n1"
},
{
"input": "rrlll",
"output": "1\n2\n5\n4\n3"
},
{
"input": "lrlrr",
"output": "2\n4\n5\n3\n1"
},
{
"input": "lllrlrllrl",
"output": "4\n6\n9\n10\n8\n7\n5\n3\n2\n1"
},
{
"input": "llrlrrrlrr",
"output": "3\n5\n6\n7\n9\n10\n8\n4\n2\n1"
},
{
"input": "rlrrrllrrr",
"output": "1\n3\n4\n5\n8\n9\n10\n7\n6\n2"
},
{
"input": "lrrlrrllrrrrllllllrr",
"output": "2\n3\n5\n6\n9\n10\n11\n12\n19\n20\n18\n17\n16\n15\n14\n13\n8\n7\n4\n1"
},
{
"input": "rlrrrlrrrllrrllrlrll",
"output": "1\n3\n4\n5\n7\n8\n9\n12\n13\n16\n18\n20\n19\n17\n15\n14\n11\n10\n6\n2"
},
{
"input": "lllrrlrlrllrrrrrllrl",
"output": "4\n5\n7\n9\n12\n13\n14\n15\n16\n19\n20\n18\n17\n11\n10\n8\n6\n3\n2\n1"
},
{
"input": "rrrllrrrlllrlllrlrrr",
"output": "1\n2\n3\n6\n7\n8\n12\n16\n18\n19\n20\n17\n15\n14\n13\n11\n10\n9\n5\n4"
},
{
"input": "rrlllrrrlrrlrrrlllrlrlrrrlllrllrrllrllrrlrlrrllllrlrrrrlrlllrlrrrlrlrllrlrlrrlrrllrrrlrlrlllrrllllrl",
"output": "1\n2\n6\n7\n8\n10\n11\n13\n14\n15\n19\n21\n23\n24\n25\n29\n32\n33\n36\n39\n40\n42\n44\n45\n50\n52\n53\n54\n55\n57\n61\n63\n64\n65\n67\n69\n72\n74\n76\n77\n79\n80\n83\n84\n85\n87\n89\n93\n94\n99\n100\n98\n97\n96\n95\n92\n91\n90\n88\n86\n82\n81\n78\n75\n73\n71\n70\n68\n66\n62\n60\n59\n58\n56\n51\n49\n48\n47\n46\n43\n41\n38\n37\n35\n34\n31\n30\n28\n27\n26\n22\n20\n18\n17\n16\n12\n9\n5\n4\n3"
},
{
"input": "llrlrlllrrllrllllrlrrlrlrrllrlrlrrlrrrrrrlllrrlrrrrrlrrrlrlrlrrlllllrrrrllrrlrlrrrllllrlrrlrrlrlrrll",
"output": "3\n5\n9\n10\n13\n18\n20\n21\n23\n25\n26\n29\n31\n33\n34\n36\n37\n38\n39\n40\n41\n45\n46\n48\n49\n50\n51\n52\n54\n55\n56\n58\n60\n62\n63\n69\n70\n71\n72\n75\n76\n78\n80\n81\n82\n87\n89\n90\n92\n93\n95\n97\n98\n100\n99\n96\n94\n91\n88\n86\n85\n84\n83\n79\n77\n74\n73\n68\n67\n66\n65\n64\n61\n59\n57\n53\n47\n44\n43\n42\n35\n32\n30\n28\n27\n24\n22\n19\n17\n16\n15\n14\n12\n11\n8\n7\n6\n4\n2\n1"
},
{
"input": "llrrrrllrrlllrlrllrlrllllllrrrrrrrrllrrrrrrllrlrrrlllrrrrrrlllllllrrlrrllrrrllllrrlllrrrlrlrrlrlrllr",
"output": "3\n4\n5\n6\n9\n10\n14\n16\n19\n21\n28\n29\n30\n31\n32\n33\n34\n35\n38\n39\n40\n41\n42\n43\n46\n48\n49\n50\n54\n55\n56\n57\n58\n59\n67\n68\n70\n71\n74\n75\n76\n81\n82\n86\n87\n88\n90\n92\n93\n95\n97\n100\n99\n98\n96\n94\n91\n89\n85\n84\n83\n80\n79\n78\n77\n73\n72\n69\n66\n65\n64\n63\n62\n61\n60\n53\n52\n51\n47\n45\n44\n37\n36\n27\n26\n25\n24\n23\n22\n20\n18\n17\n15\n13\n12\n11\n8\n7\n2\n1"
},
{
"input": "lllllrllrrlllrrrllrrrrlrrlrllllrrrrrllrlrllllllrrlrllrlrllrlrrlrlrrlrrrlrrrrllrlrrrrrrrllrllrrlrllrl",
"output": "6\n9\n10\n14\n15\n16\n19\n20\n21\n22\n24\n25\n27\n32\n33\n34\n35\n36\n39\n41\n48\n49\n51\n54\n56\n59\n61\n62\n64\n66\n67\n69\n70\n71\n73\n74\n75\n76\n79\n81\n82\n83\n84\n85\n86\n87\n90\n93\n94\n96\n99\n100\n98\n97\n95\n92\n91\n89\n88\n80\n78\n77\n72\n68\n65\n63\n60\n58\n57\n55\n53\n52\n50\n47\n46\n45\n44\n43\n42\n40\n38\n37\n31\n30\n29\n28\n26\n23\n18\n17\n13\n12\n11\n8\n7\n5\n4\n3\n2\n1"
},
{
"input": "llrlrlrlrlrlrrlllllllrllllrllrrrlllrrllrllrrlllrrlllrlrrllllrrlllrrllrrllllrrlllrlllrrrllrrrrrrllrrl",
"output": "3\n5\n7\n9\n11\n13\n14\n22\n27\n30\n31\n32\n36\n37\n40\n43\n44\n48\n49\n53\n55\n56\n61\n62\n66\n67\n70\n71\n76\n77\n81\n85\n86\n87\n90\n91\n92\n93\n94\n95\n98\n99\n100\n97\n96\n89\n88\n84\n83\n82\n80\n79\n78\n75\n74\n73\n72\n69\n68\n65\n64\n63\n60\n59\n58\n57\n54\n52\n51\n50\n47\n46\n45\n42\n41\n39\n38\n35\n34\n33\n29\n28\n26\n25\n24\n23\n21\n20\n19\n18\n17\n16\n15\n12\n10\n8\n6\n4\n2\n1"
},
{
"input": "l",
"output": "1"
},
{
"input": "r",
"output": "1"
}
] | 1,689,398,369 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 57 | 436 | 11,468,800 | from sys import stdin
def input(): return stdin.readline().rstrip("\r\n")
s = input()
for i in range(len(s)):
if s[i] == 'r':
print(i+1)
for j in range(len(s)-1,-1,-1):
if s[j] == 'l':
print(j+1) | Title: Escape from Stones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Squirrel Liss lived in a forest peacefully, but unexpected trouble happens. Stones fall from a mountain. Initially Squirrel Liss occupies an interval [0,<=1]. Next, *n* stones will fall and Liss will escape from the stones. The stones are numbered from 1 to *n* in order.
The stones always fall to the center of Liss's interval. When Liss occupies the interval [*k*<=-<=*d*,<=*k*<=+<=*d*] and a stone falls to *k*, she will escape to the left or to the right. If she escapes to the left, her new interval will be [*k*<=-<=*d*,<=*k*]. If she escapes to the right, her new interval will be [*k*,<=*k*<=+<=*d*].
You are given a string *s* of length *n*. If the *i*-th character of *s* is "l" or "r", when the *i*-th stone falls Liss will escape to the left or to the right, respectively. Find the sequence of stones' numbers from left to right after all the *n* stones falls.
Input Specification:
The input consists of only one line. The only line contains the string *s* (1<=≤<=|*s*|<=≤<=106). Each character in *s* will be either "l" or "r".
Output Specification:
Output *n* lines — on the *i*-th line you should print the *i*-th stone's number from the left.
Demo Input:
['llrlr\n', 'rrlll\n', 'lrlrr\n']
Demo Output:
['3\n5\n4\n2\n1\n', '1\n2\n5\n4\n3\n', '2\n4\n5\n3\n1\n']
Note:
In the first example, the positions of stones 1, 2, 3, 4, 5 will be <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/58fdb5684df807bfcb705a9da9ce175613362b7d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, respectively. So you should print the sequence: 3, 5, 4, 2, 1. | ```python
from sys import stdin
def input(): return stdin.readline().rstrip("\r\n")
s = input()
for i in range(len(s)):
if s[i] == 'r':
print(i+1)
for j in range(len(s)-1,-1,-1):
if s[j] == 'l':
print(j+1)
``` | 3 |
|
977 | E | Cyclic Components | PROGRAMMING | 1,500 | [
"dfs and similar",
"dsu",
"graphs"
] | null | null | You are given an undirected graph consisting of $n$ vertices and $m$ edges. Your task is to find the number of connected components which are cycles.
Here are some definitions of graph theory.
An undirected graph consists of two sets: set of nodes (called vertices) and set of edges. Each edge connects a pair of vertices. All edges are bidirectional (i.e. if a vertex $a$ is connected with a vertex $b$, a vertex $b$ is also connected with a vertex $a$). An edge can't connect vertex with itself, there is at most one edge between a pair of vertices.
Two vertices $u$ and $v$ belong to the same connected component if and only if there is at least one path along edges connecting $u$ and $v$.
A connected component is a cycle if and only if its vertices can be reordered in such a way that:
- the first vertex is connected with the second vertex by an edge, - the second vertex is connected with the third vertex by an edge, - ... - the last vertex is connected with the first vertex by an edge, - all the described edges of a cycle are distinct.
A cycle doesn't contain any other edges except described above. By definition any cycle contains three or more vertices. | The first line contains two integer numbers $n$ and $m$ ($1 \le n \le 2 \cdot 10^5$, $0 \le m \le 2 \cdot 10^5$) — number of vertices and edges.
The following $m$ lines contains edges: edge $i$ is given as a pair of vertices $v_i$, $u_i$ ($1 \le v_i, u_i \le n$, $u_i \ne v_i$). There is no multiple edges in the given graph, i.e. for each pair ($v_i, u_i$) there no other pairs ($v_i, u_i$) and ($u_i, v_i$) in the list of edges. | Print one integer — the number of connected components which are also cycles. | [
"5 4\n1 2\n3 4\n5 4\n3 5\n",
"17 15\n1 8\n1 12\n5 11\n11 9\n9 15\n15 5\n4 13\n3 13\n4 3\n10 16\n7 10\n16 7\n14 3\n14 4\n17 6\n"
] | [
"1\n",
"2\n"
] | In the first example only component $[3, 4, 5]$ is also a cycle.
The illustration above corresponds to the second example. | 0 | [
{
"input": "5 4\n1 2\n3 4\n5 4\n3 5",
"output": "1"
},
{
"input": "17 15\n1 8\n1 12\n5 11\n11 9\n9 15\n15 5\n4 13\n3 13\n4 3\n10 16\n7 10\n16 7\n14 3\n14 4\n17 6",
"output": "2"
},
{
"input": "4 4\n1 2\n2 3\n1 3\n1 4",
"output": "0"
},
{
"input": "5 5\n1 2\n2 3\n3 4\n4 1\n3 5",
"output": "0"
},
{
"input": "200000 0",
"output": "0"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "5 10\n1 2\n2 3\n3 4\n4 5\n5 1\n1 4\n2 4\n3 5\n3 1\n2 5",
"output": "0"
},
{
"input": "5 10\n1 2\n1 3\n1 4\n1 5\n2 3\n2 4\n2 5\n3 4\n3 5\n4 5",
"output": "0"
},
{
"input": "6 9\n1 2\n2 3\n3 4\n4 5\n5 6\n6 1\n6 2\n2 4\n6 4",
"output": "0"
},
{
"input": "4 6\n1 2\n2 3\n3 4\n4 1\n1 3\n2 4",
"output": "0"
}
] | 1,697,065,110 | 6,210 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 3 | 811 | 64,819,200 |
class MyNode:
def __init__(self, k) -> None:
self.k = k
self.connections = set([])
def connect(self, x):
self.connections.add(x)
class Solution:
def __init__(self, n, m, edges):
self.n = n
self.m = m
self.nodes = {}
self.buildGraph(edges)
def connectNodes(self, a, b):
if a not in self.nodes:
self.createNode(a)
if b not in self.nodes:
self.createNode(b)
node_a = self.nodes[a]
node_b = self.nodes[b]
node_a.connect(b)
node_b.connect(a)
def createNode(self, k):
self.nodes[k] = MyNode(k)
def buildGraph(self, edges):
for (a, b) in edges:
self.connectNodes(a, b)
def explore(self, k):
if k in self.seen:
return
node = self.nodes[k]
self.seen.add(k)
self.nodeCount += 1
if len(node.connections) != 2:
self.cyclePossible = False
for c in node.connections:
self.edgeCount += 1
self.explore(c)
def cycleHere(self, k):
if k in self.seen:
return False
self.edgeCount = 0
self.nodeCount = 0
self.cyclePossible = True
self.explore(k)
if not self.cyclePossible or (self.edgeCount % 2 != 0):
return False
return (self.edgeCount//2) == self.nodeCount
def solve(self):
self.seen = set()
count = 0
for k in self.nodes:
if self.cycleHere(k):
count += 1
return count
def readEdges(m):
edges = []
for i in range(m):
arr = [int(x) for x in input().split(" ")]
edges.append(arr)
return edges
arr = input().split(" ")
n = int(arr[0])
m = int(arr[1])
solver = Solution(n, m, readEdges(m))
ans = solver.solve()
print(ans)
| Title: Cyclic Components
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an undirected graph consisting of $n$ vertices and $m$ edges. Your task is to find the number of connected components which are cycles.
Here are some definitions of graph theory.
An undirected graph consists of two sets: set of nodes (called vertices) and set of edges. Each edge connects a pair of vertices. All edges are bidirectional (i.e. if a vertex $a$ is connected with a vertex $b$, a vertex $b$ is also connected with a vertex $a$). An edge can't connect vertex with itself, there is at most one edge between a pair of vertices.
Two vertices $u$ and $v$ belong to the same connected component if and only if there is at least one path along edges connecting $u$ and $v$.
A connected component is a cycle if and only if its vertices can be reordered in such a way that:
- the first vertex is connected with the second vertex by an edge, - the second vertex is connected with the third vertex by an edge, - ... - the last vertex is connected with the first vertex by an edge, - all the described edges of a cycle are distinct.
A cycle doesn't contain any other edges except described above. By definition any cycle contains three or more vertices.
Input Specification:
The first line contains two integer numbers $n$ and $m$ ($1 \le n \le 2 \cdot 10^5$, $0 \le m \le 2 \cdot 10^5$) — number of vertices and edges.
The following $m$ lines contains edges: edge $i$ is given as a pair of vertices $v_i$, $u_i$ ($1 \le v_i, u_i \le n$, $u_i \ne v_i$). There is no multiple edges in the given graph, i.e. for each pair ($v_i, u_i$) there no other pairs ($v_i, u_i$) and ($u_i, v_i$) in the list of edges.
Output Specification:
Print one integer — the number of connected components which are also cycles.
Demo Input:
['5 4\n1 2\n3 4\n5 4\n3 5\n', '17 15\n1 8\n1 12\n5 11\n11 9\n9 15\n15 5\n4 13\n3 13\n4 3\n10 16\n7 10\n16 7\n14 3\n14 4\n17 6\n']
Demo Output:
['1\n', '2\n']
Note:
In the first example only component $[3, 4, 5]$ is also a cycle.
The illustration above corresponds to the second example. | ```python
class MyNode:
def __init__(self, k) -> None:
self.k = k
self.connections = set([])
def connect(self, x):
self.connections.add(x)
class Solution:
def __init__(self, n, m, edges):
self.n = n
self.m = m
self.nodes = {}
self.buildGraph(edges)
def connectNodes(self, a, b):
if a not in self.nodes:
self.createNode(a)
if b not in self.nodes:
self.createNode(b)
node_a = self.nodes[a]
node_b = self.nodes[b]
node_a.connect(b)
node_b.connect(a)
def createNode(self, k):
self.nodes[k] = MyNode(k)
def buildGraph(self, edges):
for (a, b) in edges:
self.connectNodes(a, b)
def explore(self, k):
if k in self.seen:
return
node = self.nodes[k]
self.seen.add(k)
self.nodeCount += 1
if len(node.connections) != 2:
self.cyclePossible = False
for c in node.connections:
self.edgeCount += 1
self.explore(c)
def cycleHere(self, k):
if k in self.seen:
return False
self.edgeCount = 0
self.nodeCount = 0
self.cyclePossible = True
self.explore(k)
if not self.cyclePossible or (self.edgeCount % 2 != 0):
return False
return (self.edgeCount//2) == self.nodeCount
def solve(self):
self.seen = set()
count = 0
for k in self.nodes:
if self.cycleHere(k):
count += 1
return count
def readEdges(m):
edges = []
for i in range(m):
arr = [int(x) for x in input().split(" ")]
edges.append(arr)
return edges
arr = input().split(" ")
n = int(arr[0])
m = int(arr[1])
solver = Solution(n, m, readEdges(m))
ans = solver.solve()
print(ans)
``` | -1 |
|
688 | B | Lovely Palindromes | PROGRAMMING | 1,000 | [
"constructive algorithms",
"math"
] | null | null | Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number? | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000). | Print the *n*-th even-length palindrome number. | [
"1\n",
"10\n"
] | [
"11\n",
"1001\n"
] | The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001. | 1,000 | [
{
"input": "1",
"output": "11"
},
{
"input": "10",
"output": "1001"
},
{
"input": "11",
"output": "1111"
},
{
"input": "12",
"output": "1221"
},
{
"input": "100",
"output": "100001"
},
{
"input": "1321",
"output": "13211231"
},
{
"input": "2",
"output": "22"
},
{
"input": "3",
"output": "33"
},
{
"input": "4",
"output": "44"
},
{
"input": "5",
"output": "55"
},
{
"input": "6",
"output": "66"
},
{
"input": "7",
"output": "77"
},
{
"input": "8",
"output": "88"
},
{
"input": "9",
"output": "99"
},
{
"input": "13",
"output": "1331"
},
{
"input": "14",
"output": "1441"
},
{
"input": "15",
"output": "1551"
},
{
"input": "16",
"output": "1661"
},
{
"input": "17",
"output": "1771"
},
{
"input": "18",
"output": "1881"
},
{
"input": "19",
"output": "1991"
},
{
"input": "20",
"output": "2002"
},
{
"input": "26550",
"output": "2655005562"
},
{
"input": "16137",
"output": "1613773161"
},
{
"input": "91471",
"output": "9147117419"
},
{
"input": "41242",
"output": "4124224214"
},
{
"input": "30866",
"output": "3086666803"
},
{
"input": "4442231232741003009964183199713851566466079882929007253443848371978048610682180431295671905105980116",
"output": "44422312327410030099641831997138515664660798829290072534438483719780486106821804312956719051059801166110895015091765921340812860168408791738483443527009292889706646651583179913814699003001472321322444"
},
{
"input": "7806526084732010742850470902979267046151204705563201965818390803445852115032119297648697933316807252",
"output": "78065260847320107428504709029792670461512047055632019658183908034458521150321192976486979333168072522527086133397968467929112305112585443080938185691023655074021516407629792090740582470102374806256087"
},
{
"input": "2244399823612183124978103773977739948197709395321563148611877999503840818596183803323258317041875913",
"output": "22443998236121831249781037739777399481977093953215631486118779995038408185961838033232583170418759133195781407138523233083816958180483059997781168413651235939077918499377793773018794213812163289934422"
},
{
"input": "123451",
"output": "123451154321"
}
] | 1,675,847,537 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 1,000 | 307,200 | import sys,random,bisect
from collections import deque,defaultdict
from heapq import heapify,heappop,heappush
from math import gcd
MOD = int(1e9 + 7)
INF = int(1e20)
input = lambda :sys.stdin.readline().rstrip()
mi = lambda :map(int,input().split())
li = lambda :list(mi())
ii = lambda :int(input())
n=ii()
print(str(n)+str(n)[::-1])
| Title: Lovely Palindromes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
Output Specification:
Print the *n*-th even-length palindrome number.
Demo Input:
['1\n', '10\n']
Demo Output:
['11\n', '1001\n']
Note:
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001. | ```python
import sys,random,bisect
from collections import deque,defaultdict
from heapq import heapify,heappop,heappush
from math import gcd
MOD = int(1e9 + 7)
INF = int(1e20)
input = lambda :sys.stdin.readline().rstrip()
mi = lambda :map(int,input().split())
li = lambda :list(mi())
ii = lambda :int(input())
n=ii()
print(str(n)+str(n)[::-1])
``` | 0 |
|
867 | A | Between the Offices | PROGRAMMING | 800 | [
"implementation"
] | null | null | As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not. | The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence. | Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower). | [
"4\nFSSF\n",
"2\nSF\n",
"10\nFFFFFFFFFF\n",
"10\nSSFFSFFSFF\n"
] | [
"NO\n",
"YES\n",
"NO\n",
"YES\n"
] | In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | 500 | [
{
"input": "4\nFSSF",
"output": "NO"
},
{
"input": "2\nSF",
"output": "YES"
},
{
"input": "10\nFFFFFFFFFF",
"output": "NO"
},
{
"input": "10\nSSFFSFFSFF",
"output": "YES"
},
{
"input": "20\nSFSFFFFSSFFFFSSSSFSS",
"output": "NO"
},
{
"input": "20\nSSFFFFFSFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "20\nSSFSFSFSFSFSFSFSSFSF",
"output": "YES"
},
{
"input": "20\nSSSSFSFSSFSFSSSSSSFS",
"output": "NO"
},
{
"input": "100\nFFFSFSFSFSSFSFFSSFFFFFSSSSFSSFFFFSFFFFFSFFFSSFSSSFFFFSSFFSSFSFFSSFSSSFSFFSFSFFSFSFFSSFFSFSSSSFSFSFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFSS",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFFSFFFFFFFFFSFSSFFFFFFFFFFFFFFFFFFFFFFSFFSFFFFFSFFFFFFFFSFFFFFFFFFFFFFSFFFFFFFFSFFFFFFFSF",
"output": "NO"
},
{
"input": "100\nSFFSSFFFFFFSSFFFSSFSFFFFFSSFFFSFFFFFFSFSSSFSFSFFFFSFSSFFFFFFFFSFFFFFSFFFFFSSFFFSFFSFSFFFFSFFSFFFFFFF",
"output": "YES"
},
{
"input": "100\nFFFFSSSSSFFSSSFFFSFFFFFSFSSFSFFSFFSSFFSSFSFFFFFSFSFSFSFFFFFFFFFSFSFFSFFFFSFSFFFFFFFFFFFFSFSSFFSSSSFF",
"output": "NO"
},
{
"input": "100\nFFFFFFFFFFFFSSFFFFSFSFFFSFSSSFSSSSSFSSSSFFSSFFFSFSFSSFFFSSSFFSFSFSSFSFSSFSFFFSFFFFFSSFSFFFSSSFSSSFFS",
"output": "NO"
},
{
"input": "100\nFFFSSSFSFSSSSFSSFSFFSSSFFSSFSSFFSSFFSFSSSSFFFSFFFSFSFSSSFSSFSFSFSFFSSSSSFSSSFSFSFFSSFSFSSFFSSFSFFSFS",
"output": "NO"
},
{
"input": "100\nFFSSSSFSSSFSSSSFSSSFFSFSSFFSSFSSSFSSSFFSFFSSSSSSSSSSSSFSSFSSSSFSFFFSSFFFFFFSFSFSSSSSSFSSSFSFSSFSSFSS",
"output": "NO"
},
{
"input": "100\nSSSFFFSSSSFFSSSSSFSSSSFSSSFSSSSSFSSSSSSSSFSFFSSSFFSSFSSSSFFSSSSSSFFSSSSFSSSSSSFSSSFSSSSSSSFSSSSFSSSS",
"output": "NO"
},
{
"input": "100\nFSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSSSSSSFSSSSSSSSSSSSSFSSFSSSSSFSSFSSSSSSSSSFFSSSSSFSFSSSFFSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSFSSSSSSSSSSSSFSSSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFSSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSFS",
"output": "NO"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS",
"output": "NO"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFSFSFFFFFFFFFFFSFSFFFFFFFFFFFFFSFFFFFFFFFFFFFFFFFFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSFFFFFFFFFFFFSSFFFFSFFFFFFFFFFFFFFFFFFFSFFFSSFFFFSFSFFFSFFFFFFFFFFFFFFFSSFFFFFFFFSSFFFFFFFFFFFFFFSFF",
"output": "YES"
},
{
"input": "100\nSFFSSSFFSFSFSFFFFSSFFFFSFFFFFFFFSFSFFFSFFFSFFFSFFFFSFSFFFFFFFSFFFFFFFFFFSFFSSSFFSSFFFFSFFFFSFFFFSFFF",
"output": "YES"
},
{
"input": "100\nSFFFSFFFFSFFFSSFFFSFSFFFSFFFSSFSFFFFFSFFFFFFFFSFSFSFFSFFFSFSSFSFFFSFSFFSSFSFSSSFFFFFFSSFSFFSFFFFFFFF",
"output": "YES"
},
{
"input": "100\nSSSSFFFFSFFFFFFFSFFFFSFSFFFFSSFFFFFFFFFSFFSSFFFFFFSFSFSSFSSSFFFFFFFSFSFFFSSSFFFFFFFSFFFSSFFFFSSFFFSF",
"output": "YES"
},
{
"input": "100\nSSSFSSFFFSFSSSSFSSFSSSSFSSFFFFFSFFSSSSFFSSSFSSSFSSSSFSSSSFSSSSSSSFSFSSFFFSSFFSFFSSSSFSSFFSFSSFSFFFSF",
"output": "YES"
},
{
"input": "100\nSFFSFSSSSSSSFFSSSFSSSSFSFSSFFFSSSSSSFSSSSFSSFSSSFSSSSSSSFSSFSFFFSSFSSFSFSFSSSSSSSSSSSSFFFFSSSSSFSFFF",
"output": "YES"
},
{
"input": "100\nSSSFSFFSFSFFSSSSSFSSSFSSSFFFSSSSSSSSSFSFSFSSSSFSFSSFFFFFSSSSSSSSSSSSSSSSSSSFFSSSSSFSFSSSSFFSSSSFSSSF",
"output": "YES"
},
{
"input": "100\nSSSFSSSSSSSSSSFSSSSFSSSSSSFSSSSSSFSSSSSSSSSSSSSSFSSSFSSSFSSSSSSSSSSSFSSSSSSFSFSSSSFSSSSSSFSSSSSSSSFF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSFSFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSFFSSSSSSSSSFSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "100\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSF",
"output": "YES"
},
{
"input": "2\nSS",
"output": "NO"
}
] | 1,562,603,113 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 109 | 0 | from sys import stdin
n = int(stdin.readline())
days = stdin.readline()
more = 0
for i in range(0, n-1):
if days[i] != days[i+1]:
if days[i+1] == "F":
more += 1
else:
more -= 1
if (more > 0):
print("YES")
else:
print("NO")
| Title: Between the Offices
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you may know, MemSQL has American offices in both San Francisco and Seattle. Being a manager in the company, you travel a lot between the two cities, always by plane.
You prefer flying from Seattle to San Francisco than in the other direction, because it's warmer in San Francisco. You are so busy that you don't remember the number of flights you have made in either direction. However, for each of the last *n* days you know whether you were in San Francisco office or in Seattle office. You always fly at nights, so you never were at both offices on the same day. Given this information, determine if you flew more times from Seattle to San Francisco during the last *n* days, or not.
Input Specification:
The first line of input contains single integer *n* (2<=≤<=*n*<=≤<=100) — the number of days.
The second line contains a string of length *n* consisting of only capital 'S' and 'F' letters. If the *i*-th letter is 'S', then you were in Seattle office on that day. Otherwise you were in San Francisco. The days are given in chronological order, i.e. today is the last day in this sequence.
Output Specification:
Print "YES" if you flew more times from Seattle to San Francisco, and "NO" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['4\nFSSF\n', '2\nSF\n', '10\nFFFFFFFFFF\n', '10\nSSFFSFFSFF\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n', 'YES\n']
Note:
In the first example you were initially at San Francisco, then flew to Seattle, were there for two days and returned to San Francisco. You made one flight in each direction, so the answer is "NO".
In the second example you just flew from Seattle to San Francisco, so the answer is "YES".
In the third example you stayed the whole period in San Francisco, so the answer is "NO".
In the fourth example if you replace 'S' with ones, and 'F' with zeros, you'll get the first few digits of π in binary representation. Not very useful information though. | ```python
from sys import stdin
n = int(stdin.readline())
days = stdin.readline()
more = 0
for i in range(0, n-1):
if days[i] != days[i+1]:
if days[i+1] == "F":
more += 1
else:
more -= 1
if (more > 0):
print("YES")
else:
print("NO")
``` | 3 |
|
733 | A | Grasshopper And the String | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'. | The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100. | Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels. | [
"ABABBBACFEYUKOTT\n",
"AAA\n"
] | [
"4",
"1"
] | none | 500 | [
{
"input": "ABABBBACFEYUKOTT",
"output": "4"
},
{
"input": "AAA",
"output": "1"
},
{
"input": "A",
"output": "1"
},
{
"input": "B",
"output": "2"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIKLMJNHGTRWSDZXCVBNMHGFDSXVWRTPPPLKMNBXIUOIUOIUOIUOOIU",
"output": "39"
},
{
"input": "AEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOIAEYUIOAEIYAEOUIYOEIUYEAOIUEOEAYOEIUYAEOUIYEOI",
"output": "1"
},
{
"input": "KMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVCKMLPTGFHNBVCDRFGHNMBVXWSQFDCVBNHTJKLPMNFVC",
"output": "85"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZXCVBNMQWERTYUIOPASDFGHJKLZ",
"output": "18"
},
{
"input": "PKLKBWTXVJ",
"output": "11"
},
{
"input": "CFHFPTGMOKXVLJJZJDQW",
"output": "12"
},
{
"input": "TXULTFSBUBFLRNQORMMULWNVLPWTYJXZBPBGAWNX",
"output": "9"
},
{
"input": "DAIUSEAUEUYUWEIOOEIOUYVYYOPEEWEBZOOOAOXUOIEUKYYOJOYAUYUUIYUXOUJLGIYEIIYUOCUAACRY",
"output": "4"
},
{
"input": "VRPHBNWNWVWBWMFJJDCTJQJDJBKSJRZLVQRVVFLTZFSGCGDXCWQVWWWMFVCQHPKXXVRKTGWGPSMQTPKNDQJHNSKLXPCXDJDQDZZD",
"output": "101"
},
{
"input": "SGDDFCDRDWGPNNFBBZZJSPXFYMZKPRXTCHVJSJJBWZXXQMDZBNKDHRGSRLGLRKPMWXNSXJPNJLDPXBSRCQMHJKPZNTPNTZXNPCJC",
"output": "76"
},
{
"input": "NVTQVNLGWFDBCBKSDLTBGWBMNQZWZQJWNGVCTCQBGWNTYJRDBPZJHXCXFMIXNRGSTXHQPCHNFQPCMDZWJGLJZWMRRFCVLBKDTDSC",
"output": "45"
},
{
"input": "SREZXQFVPQCLRCQGMKXCBRWKYZKWKRMZGXPMKWNMFZTRDPHJFCSXVPPXWKZMZTBFXGNLPLHZIPLFXNRRQFDTLFPKBGCXKTMCFKKT",
"output": "48"
},
{
"input": "ICKJKMVPDNZPLKDSLTPZNRLSQSGHQJQQPJJSNHNWVDLJRLZEJSXZDPHYXGGWXHLCTVQSKWNWGTLJMOZVJNZPVXGVPJKHFVZTGCCX",
"output": "47"
},
{
"input": "XXFPZDRPXLNHGDVCBDKJMKLGUQZXLLWYLOKFZVGXVNPJWZZZNRMQBRJCZTSDRHSNCVDMHKVXCXPCRBWSJCJWDRDPVZZLCZRTDRYA",
"output": "65"
},
{
"input": "HDDRZDKCHHHEDKHZMXQSNQGSGNNSCCPVJFGXGNCEKJMRKSGKAPQWPCWXXWHLSMRGSJWEHWQCSJJSGLQJXGVTBYALWMLKTTJMFPFS",
"output": "28"
},
{
"input": "PXVKJHXVDPWGLHWFWMJPMCCNHCKSHCPZXGIHHNMYNFQBUCKJJTXXJGKRNVRTQFDFMLLGPQKFOVNNLTNDIEXSARRJKGSCZKGGJCBW",
"output": "35"
},
{
"input": "EXNMTTFPJLDHXDQBJJRDRYBZVFFHUDCHCPNFZWXSMZXNFVJGHZWXVBRQFNUIDVLZOVPXQNVMFNBTJDSCKRLNGXPSADTGCAHCBJKL",
"output": "30"
},
{
"input": "NRNLSQQJGIJBCZFTNKJCXMGPARGWXPSHZXOBNSFOLDQVXTVAGJZNLXULHBRDGMNQKQGWMRRDPYCSNFVPUFTFBUBRXVJGNGSPJKLL",
"output": "19"
},
{
"input": "SRHOKCHQQMVZKTCVQXJJCFGYFXGMBZSZFNAFETXILZHPGHBWZRZQFMGSEYRUDVMCIQTXTBTSGFTHRRNGNTHHWWHCTDFHSVARMCMB",
"output": "30"
},
{
"input": "HBSVZHDKGNIRQUBYKYHUPJCEETGFMVBZJTHYHFQPFBVBSMQACYAVWZXSBGNKWXFNMQJFMSCHJVWBZXZGSNBRUHTHAJKVLEXFBOFB",
"output": "34"
},
{
"input": "NXKMUGOPTUQNSRYTKUKSCWCRQSZKKFPYUMDIBJAHJCEKZJVWZAWOLOEFBFXLQDDPNNZKCQHUPBFVDSXSUCVLMZXQROYQYIKPQPWR",
"output": "17"
},
{
"input": "TEHJDICFNOLQVQOAREVAGUAWODOCXJXIHYXFAEPEXRHPKEIIRCRIVASKNTVYUYDMUQKSTSSBYCDVZKDDHTSDWJWACPCLYYOXGCLT",
"output": "15"
},
{
"input": "LCJJUZZFEIUTMSEXEYNOOAIZMORQDOANAMUCYTFRARDCYHOYOPHGGYUNOGNXUAOYSEMXAZOOOFAVHQUBRNGORSPNQWZJYQQUNPEB",
"output": "9"
},
{
"input": "UUOKAOOJBXUTSMOLOOOOSUYYFTAVBNUXYFVOOGCGZYQEOYISIYOUULUAIJUYVVOENJDOCLHOSOHIHDEJOIGZNIXEMEGZACHUAQFW",
"output": "5"
},
{
"input": "OUUBEHXOOURMOAIAEHXCUOIYHUJEVAWYRCIIAGDRIPUIPAIUYAIWJEVYEYYUYBYOGVYESUJCFOJNUAHIOOKBUUHEJFEWPOEOUHYA",
"output": "4"
},
{
"input": "EMNOYEEUIOUHEWZITIAEZNCJUOUAOQEAUYEIHYUSUYUUUIAEDIOOERAEIRBOJIEVOMECOGAIAIUIYYUWYIHIOWVIJEYUEAFYULSE",
"output": "5"
},
{
"input": "BVOYEAYOIEYOREJUYEUOEOYIISYAEOUYAAOIOEOYOOOIEFUAEAAESUOOIIEUAAGAEISIAPYAHOOEYUJHUECGOYEIDAIRTBHOYOYA",
"output": "5"
},
{
"input": "GOIEOAYIEYYOOEOAIAEOOUWYEIOTNYAANAYOOXEEOEAVIOIAAIEOIAUIAIAAUEUAOIAEUOUUZYIYAIEUEGOOOOUEIYAEOSYAEYIO",
"output": "3"
},
{
"input": "AUEAOAYIAOYYIUIOAULIOEUEYAIEYYIUOEOEIEYRIYAYEYAEIIMMAAEAYAAAAEOUICAUAYOUIAOUIAIUOYEOEEYAEYEYAAEAOYIY",
"output": "3"
},
{
"input": "OAIIYEYYAOOEIUOEEIOUOIAEFIOAYETUYIOAAAEYYOYEYOEAUIIUEYAYYIIAOIEEYGYIEAAOOWYAIEYYYIAOUUOAIAYAYYOEUEOY",
"output": "2"
},
{
"input": "EEEAOEOEEIOUUUEUEAAOEOIUYJEYAIYIEIYYEAUOIIYIUOOEUCYEOOOYYYIUUAYIAOEUEIEAOUOIAACAOOUAUIYYEAAAOOUYIAAE",
"output": "2"
},
{
"input": "AYEYIIEUIYOYAYEUEIIIEUYUUAUEUIYAIAAUYONIEYIUIAEUUOUOYYOUUUIUIAEYEOUIIUOUUEOAIUUYAAEOAAEOYUUIYAYRAIII",
"output": "2"
},
{
"input": "YOOAAUUAAAYEUYIUIUYIUOUAEIEEIAUEOAUIIAAIUYEUUOYUIYEAYAAAYUEEOEEAEOEEYYOUAEUYEEAIIYEUEYJOIIYUIOIUOIEE",
"output": "2"
},
{
"input": "UYOIIIAYOOAIUUOOEEUYIOUAEOOEIOUIAIEYOAEAIOOEOOOIUYYUYIAAUIOUYYOOUAUIEYYUOAAUUEAAIEUIAUEUUIAUUOYOAYIU",
"output": "1"
},
{
"input": "ABBABBB",
"output": "4"
},
{
"input": "ABCD",
"output": "4"
},
{
"input": "XXYC",
"output": "3"
},
{
"input": "YYY",
"output": "1"
},
{
"input": "ABABBBBBBB",
"output": "8"
},
{
"input": "YYYY",
"output": "1"
},
{
"input": "YYYYY",
"output": "1"
},
{
"input": "AXXX",
"output": "4"
},
{
"input": "YYYYYYY",
"output": "1"
},
{
"input": "BYYBBB",
"output": "4"
},
{
"input": "YYYYYYYYY",
"output": "1"
},
{
"input": "CAAAAA",
"output": "2"
},
{
"input": "CCCACCCC",
"output": "5"
},
{
"input": "ABABBBACFEYUKOTTTT",
"output": "5"
},
{
"input": "AABBYYYYYYYY",
"output": "3"
},
{
"input": "BYBACYC",
"output": "2"
},
{
"input": "Y",
"output": "1"
},
{
"input": "ABBBBBB",
"output": "7"
},
{
"input": "BACDYDI",
"output": "3"
},
{
"input": "XEXXXXXXXXXXXXXXX",
"output": "16"
},
{
"input": "TTYTT",
"output": "3"
},
{
"input": "AAYBC",
"output": "3"
},
{
"input": "ABABBBACFEYUKOTTTTT",
"output": "6"
},
{
"input": "YYAYY",
"output": "1"
},
{
"input": "YZZY",
"output": "3"
},
{
"input": "YY",
"output": "1"
},
{
"input": "ZZYZZ",
"output": "3"
},
{
"input": "YBBBY",
"output": "4"
},
{
"input": "BBBACCCCCCC",
"output": "8"
},
{
"input": "YBBBBY",
"output": "5"
},
{
"input": "YYYYYYYYYY",
"output": "1"
},
{
"input": "ABABBBBBBBBBBBB",
"output": "13"
}
] | 1,666,384,014 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 5 | 93 | 2,252,800 | import re
datos = input()
lista = re.split('A|E|I|O|U',datos)
for i in range(len(lista)):
lista[i] = len(lista[i])
print(max(lista) + 1)
| Title: Grasshopper And the String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, the Grasshopper was jumping on the lawn and found a piece of paper with a string. Grasshopper became interested what is the minimum jump ability he should have in order to be able to reach the far end of the string, jumping only on vowels of the English alphabet. Jump ability is the maximum possible length of his jump.
Formally, consider that at the begginning the Grasshopper is located directly in front of the leftmost character of the string. His goal is to reach the position right after the rightmost character of the string. In one jump the Grasshopper could jump to the right any distance from 1 to the value of his jump ability.
The following letters are vowels: 'A', 'E', 'I', 'O', 'U' and 'Y'.
Input Specification:
The first line contains non-empty string consisting of capital English letters. It is guaranteed that the length of the string does not exceed 100.
Output Specification:
Print single integer *a* — the minimum jump ability of the Grasshopper (in the number of symbols) that is needed to overcome the given string, jumping only on vowels.
Demo Input:
['ABABBBACFEYUKOTT\n', 'AAA\n']
Demo Output:
['4', '1']
Note:
none | ```python
import re
datos = input()
lista = re.split('A|E|I|O|U',datos)
for i in range(len(lista)):
lista[i] = len(lista[i])
print(max(lista) + 1)
``` | 0 |
|
731 | A | Night at the Museum | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it. | The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters. | Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input. | [
"zeus\n",
"map\n",
"ares\n"
] | [
"18\n",
"35\n",
"34\n"
] | To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | 500 | [
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,621,443,197 | 2,147,483,647 | PyPy 3 | OK | TESTS | 44 | 171 | 2,048,000 | import string
letters = dict(zip(string.ascii_lowercase, range(1, 27)))
a = input()
pos = letters["a"]
total = 0
for k in a:
total += min(abs(pos - letters[k]), 26 - abs(pos - letters[k]))
pos = letters[k]
print(total) | Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations). | ```python
import string
letters = dict(zip(string.ascii_lowercase, range(1, 27)))
a = input()
pos = letters["a"]
total = 0
for k in a:
total += min(abs(pos - letters[k]), 26 - abs(pos - letters[k]))
pos = letters[k]
print(total)
``` | 3 |
|
622 | C | Not Equal on a Segment | PROGRAMMING | 1,700 | [
"data structures",
"implementation"
] | null | null | You are given array *a* with *n* integers and *m* queries. The *i*-th query is given with three integers *l**i*,<=*r**i*,<=*x**i*.
For the *i*-th query find any position *p**i* (*l**i*<=≤<=*p**i*<=≤<=*r**i*) so that *a**p**i*<=≠<=*x**i*. | The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the number of elements in *a* and the number of queries.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the elements of the array *a*.
Each of the next *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=106) — the parameters of the *i*-th query. | Print *m* lines. On the *i*-th line print integer *p**i* — the position of any number not equal to *x**i* in segment [*l**i*,<=*r**i*] or the value <=-<=1 if there is no such number. | [
"6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2\n"
] | [
"2\n6\n-1\n4\n"
] | none | 0 | [
{
"input": "6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2",
"output": "2\n6\n-1\n4"
},
{
"input": "1 1\n1\n1 1 1",
"output": "-1"
},
{
"input": "1 1\n2\n1 1 2",
"output": "-1"
},
{
"input": "1 1\n569888\n1 1 967368",
"output": "1"
},
{
"input": "10 10\n1 1 1 1 1 1 1 1 1 1\n3 10 1\n3 6 1\n1 8 1\n1 7 1\n1 5 1\n3 7 1\n4 7 1\n9 9 1\n6 7 1\n3 4 1",
"output": "-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1"
},
{
"input": "10 10\n1 2 2 2 2 1 1 2 1 1\n3 3 1\n4 9 1\n4 8 1\n2 7 2\n2 8 2\n3 10 1\n7 7 2\n10 10 2\n1 5 1\n1 2 1",
"output": "3\n8\n8\n7\n7\n8\n7\n10\n5\n2"
},
{
"input": "10 10\n318890 307761 832732 700511 820583 522866 130891 914566 128429 739710\n4 9 178864\n6 9 741003\n4 9 172997\n4 6 314469\n1 4 694802\n8 8 401658\n7 10 376243\n7 8 508771\n3 5 30038\n2 10 591490",
"output": "9\n9\n9\n6\n4\n8\n10\n8\n5\n10"
},
{
"input": "1 1\n2\n1 1 1",
"output": "1"
},
{
"input": "10 10\n1 1 1 1 1 2 1 1 1 1\n1 9 1\n6 7 1\n2 4 1\n7 8 1\n1 3 1\n10 10 1\n3 5 1\n6 7 1\n1 10 1\n6 6 1",
"output": "6\n6\n-1\n-1\n-1\n-1\n-1\n6\n6\n6"
},
{
"input": "7 1\n2 1 3 2 2 2 2\n1 7 2",
"output": "3"
},
{
"input": "4 1\n3 1 2 2\n1 4 2",
"output": "2"
},
{
"input": "6 1\n3 2 4 3 3 3\n1 6 3",
"output": "3"
},
{
"input": "4 1\n1 3 2 2\n1 4 2",
"output": "2"
},
{
"input": "5 1\n2 3 1 2 2\n1 5 2",
"output": "3"
},
{
"input": "3 1\n1 9 5\n1 3 5",
"output": "2"
},
{
"input": "4 1\n4 2 6 4\n1 4 4",
"output": "3"
},
{
"input": "2 1\n1 3\n1 2 2",
"output": "2"
},
{
"input": "10 1\n2 2 1 3 2 2 2 2 2 2\n2 5 2",
"output": "4"
},
{
"input": "7 1\n6 5 7 6 6 6 6\n1 7 6",
"output": "3"
},
{
"input": "3 1\n2 4 3\n1 3 3",
"output": "2"
},
{
"input": "4 1\n4 2 3 3\n1 4 3",
"output": "2"
},
{
"input": "5 1\n3 2 4 5 5\n1 3 3",
"output": "3"
},
{
"input": "2 6\n1 1\n1 1 1\n1 1 2\n1 2 1\n1 2 2\n2 2 1\n2 2 2",
"output": "-1\n1\n-1\n2\n-1\n2"
}
] | 1,455,295,919 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | #!/usr/bin/env python3
def acc_list(ls):
rs = []
i, j = 0, 1
while i < len(ls):
if i+j == len(ls) or ls[i] != ls[i+j]:
i += j
rs += [i for _ in range(j)]
j = 1
else:
j += 1
return rs
def find_diff(ls, rs, l, r, x):
while l < r:
if ls[l] != x:
return l
else:
l = rs[l]
return -1
def main():
_, m = [int(i) for i in input().split()]
ls = [int(i) for i in input().split()]
rs = acc_list(ls)
for _ in range(m):
l, r, x = [int(i) for i in input().split()]
print(find_diff(ls, rs, l, r, x))
if __name__ == '__main__':
main()
| Title: Not Equal on a Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array *a* with *n* integers and *m* queries. The *i*-th query is given with three integers *l**i*,<=*r**i*,<=*x**i*.
For the *i*-th query find any position *p**i* (*l**i*<=≤<=*p**i*<=≤<=*r**i*) so that *a**p**i*<=≠<=*x**i*.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=2·105) — the number of elements in *a* and the number of queries.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=106) — the elements of the array *a*.
Each of the next *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=106) — the parameters of the *i*-th query.
Output Specification:
Print *m* lines. On the *i*-th line print integer *p**i* — the position of any number not equal to *x**i* in segment [*l**i*,<=*r**i*] or the value <=-<=1 if there is no such number.
Demo Input:
['6 4\n1 2 1 1 3 5\n1 4 1\n2 6 2\n3 4 1\n3 4 2\n']
Demo Output:
['2\n6\n-1\n4\n']
Note:
none | ```python
#!/usr/bin/env python3
def acc_list(ls):
rs = []
i, j = 0, 1
while i < len(ls):
if i+j == len(ls) or ls[i] != ls[i+j]:
i += j
rs += [i for _ in range(j)]
j = 1
else:
j += 1
return rs
def find_diff(ls, rs, l, r, x):
while l < r:
if ls[l] != x:
return l
else:
l = rs[l]
return -1
def main():
_, m = [int(i) for i in input().split()]
ls = [int(i) for i in input().split()]
rs = acc_list(ls)
for _ in range(m):
l, r, x = [int(i) for i in input().split()]
print(find_diff(ls, rs, l, r, x))
if __name__ == '__main__':
main()
``` | 0 |
|
767 | A | Snacktower | PROGRAMMING | 1,100 | [
"data structures",
"implementation"
] | null | null | According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*. | Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty. | [
"3\n3 1 2\n",
"5\n4 5 1 2 3\n"
] | [
"3\n \n2 1",
"5 4\n \n \n3 2 1\n"
] | In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before. | 500 | [
{
"input": "3\n3 1 2",
"output": "3 \n\n2 1 "
},
{
"input": "5\n4 5 1 2 3",
"output": "5 4 \n\n\n3 2 1 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n1 2",
"output": "2 1 "
},
{
"input": "10\n5 1 6 2 8 3 4 10 9 7",
"output": "10 \n9 8 \n7 6 5 4 3 2 1 "
},
{
"input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7",
"output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 "
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "2\n2 1",
"output": "2 \n1 "
}
] | 1,676,874,984 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 327 | 8,704,000 | n = int(input())
l = list(map(int,input().split()))
d = {}
for i in range(n):
if l[i] == n:
print(n,end = " ")
while n - 1 in d:
print(n - 1, end = " ")
n-= 1
n -= 1
print()
else:
d[l[i]] = None
print() | Title: Snacktower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Output Specification:
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
Demo Input:
['3\n3 1 2\n', '5\n4 5 1 2 3\n']
Demo Output:
['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n']
Note:
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before. | ```python
n = int(input())
l = list(map(int,input().split()))
d = {}
for i in range(n):
if l[i] == n:
print(n,end = " ")
while n - 1 in d:
print(n - 1, end = " ")
n-= 1
n -= 1
print()
else:
d[l[i]] = None
print()
``` | 3 |
|
749 | A | Bachgold Problem | PROGRAMMING | 800 | [
"greedy",
"implementation",
"math",
"number theory"
] | null | null | Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. | The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). | The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. | [
"5\n",
"6\n"
] | [
"2\n2 3\n",
"3\n2 2 2\n"
] | none | 500 | [
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,667,152,612 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 41 | 77 | 6,656,000 | t=int(input())
if t%2==0:
x = t//2
print(x)
for i in range(x):
print(2,end=" ")
else:
x = t//2
print(x)
for i in range(x):
if i==0:
print(3,end=" ")
else:
print(2,end=" ") | Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none | ```python
t=int(input())
if t%2==0:
x = t//2
print(x)
for i in range(x):
print(2,end=" ")
else:
x = t//2
print(x)
for i in range(x):
if i==0:
print(3,end=" ")
else:
print(2,end=" ")
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$.
Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet.
The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet.
For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons.
Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well.
Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly. | The first line contains a single integer $n$ ($2 \le n \le 1000$) — number of planets.
The second line contains the only integer $m$ ($1 \le m \le 1000$) — weight of the payload.
The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel.
The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel. | If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$. | [
"2\n12\n11 8\n7 5\n",
"3\n1\n1 4 1\n2 5 3\n",
"6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n"
] | [
"10.0000000000\n",
"-1\n",
"85.4800000000\n"
] | Let's consider the first example.
Initially, the mass of a rocket with fuel is $22$ tons.
- At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel.
In the second case, the rocket will not be able even to take off from Earth. | 0 | [
{
"input": "2\n12\n11 8\n7 5",
"output": "10.0000000000"
},
{
"input": "3\n1\n1 4 1\n2 5 3",
"output": "-1"
},
{
"input": "6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3",
"output": "85.4800000000"
},
{
"input": "3\n3\n1 2 1\n2 2 2",
"output": "-1"
},
{
"input": "4\n4\n2 3 2 2\n2 3 4 3",
"output": "284.0000000000"
},
{
"input": "5\n2\n1 2 2 1 2\n4 5 1 4 1",
"output": "-1"
},
{
"input": "7\n7\n3 2 6 2 2 2 5\n4 7 5 6 2 2 2",
"output": "4697.0000000000"
},
{
"input": "2\n1000\n12 34\n56 78",
"output": "159.2650775220"
},
{
"input": "8\n4\n1 1 4 1 3 1 8 1\n1 1 1 1 1 3 1 2",
"output": "-1"
},
{
"input": "9\n2\n8 7 1 1 3 7 1 2 4\n4 1 1 8 7 7 1 1 5",
"output": "-1"
},
{
"input": "10\n10\n9 8 8 7 2 10 2 9 2 4\n3 10 6 2 6 6 5 9 4 5",
"output": "3075.7142857143"
},
{
"input": "20\n12\n3 9 12 13 16 18 9 9 19 7 2 5 17 14 7 7 15 16 5 7\n16 9 13 5 14 10 4 3 16 16 12 20 17 11 4 5 5 14 6 15",
"output": "4670.8944493007"
},
{
"input": "30\n5\n25 1 28 1 27 25 24 1 28 1 12 1 29 16 1 1 1 1 27 1 24 1 1 1 1 1 1 1 30 3\n1 22 1 1 24 2 13 1 16 21 1 27 14 16 1 1 7 1 1 18 1 23 10 1 15 16 16 15 10 1",
"output": "-1"
},
{
"input": "40\n13\n1 1 1 23 21 1 1 1 1 1 40 32 1 21 1 8 1 1 36 15 33 1 30 1 1 37 22 1 4 39 7 1 9 37 1 1 1 28 1 1\n1 34 17 1 38 20 8 14 1 18 29 3 21 21 18 14 1 11 1 1 23 1 25 1 14 1 7 31 9 20 25 1 1 1 1 8 26 12 1 1",
"output": "-1"
},
{
"input": "50\n19\n17 7 13 42 19 25 10 25 2 36 17 40 30 48 34 43 34 20 5 15 8 7 43 35 21 40 40 19 30 11 49 7 24 23 43 30 38 49 10 8 30 11 28 50 48 25 25 20 48 24\n49 35 10 22 24 50 50 7 6 13 16 35 12 43 50 44 35 33 38 49 26 18 23 37 7 38 23 20 28 48 41 16 6 32 32 34 11 39 38 9 38 23 16 31 37 47 33 20 46 30",
"output": "7832.1821424977"
},
{
"input": "60\n21\n11 35 1 28 39 13 19 56 13 13 21 25 1 1 23 1 52 26 53 1 1 1 30 39 1 7 1 1 3 1 1 10 1 1 37 1 1 25 1 1 1 53 1 3 48 1 6 5 4 15 1 14 25 53 25 38 27 1 1 1\n1 1 1 35 40 58 10 22 1 56 1 59 1 6 33 1 1 1 1 18 14 1 1 40 25 47 1 34 1 1 53 1 1 25 1 45 1 1 25 34 3 1 1 1 53 27 11 58 1 1 1 10 12 1 1 1 31 52 1 1",
"output": "-1"
},
{
"input": "70\n69\n70 66 57 58 24 60 39 2 48 61 65 22 10 26 68 62 48 25 12 14 45 57 6 30 48 15 46 33 42 28 69 42 64 25 24 8 62 12 68 53 55 20 32 70 3 5 41 49 16 26 2 34 34 20 39 65 18 47 62 31 39 28 61 67 7 14 31 31 53 54\n40 33 24 20 68 20 22 39 53 56 48 38 59 45 47 46 7 69 11 58 61 40 35 38 62 66 18 36 44 48 67 24 14 27 67 63 68 30 50 6 58 7 6 35 20 58 6 12 12 23 14 2 63 27 29 22 49 16 55 40 70 27 27 70 42 38 66 55 69 47",
"output": "217989.4794743629"
},
{
"input": "80\n21\n65 4 26 25 1 1 1 1 1 1 60 1 29 43 48 6 48 13 29 1 1 62 1 1 1 1 1 1 1 26 9 1 22 1 35 13 66 36 1 1 1 38 55 21 70 1 58 70 1 1 38 1 1 20 1 1 51 1 1 28 1 23 11 1 39 47 1 52 41 1 63 1 1 52 1 45 11 10 80 1\n1 1 25 30 1 1 55 54 1 48 10 37 22 1 74 1 78 13 1 65 32 1 1 1 1 69 5 59 1 1 65 1 40 1 31 1 1 75 54 1 60 1 1 1 1 1 1 1 11 29 36 1 72 71 52 1 1 1 37 1 1 75 43 9 53 1 62 1 29 1 40 27 59 74 41 53 19 30 1 73",
"output": "-1"
},
{
"input": "90\n35\n1 68 16 30 24 1 1 1 35 1 1 67 1 1 1 1 33 16 37 77 83 1 77 26 1 1 68 67 70 62 1 47 1 1 1 84 1 65 1 32 83 1 1 1 28 1 71 76 84 1 1 5 1 74 10 1 1 1 38 87 13 1 7 66 81 49 1 9 1 11 1 25 1 1 1 1 7 1 1 36 61 47 51 1 1 69 40 1 37 1\n40 1 21 1 19 51 37 52 64 1 86 1 5 24 1 1 1 19 36 1 1 77 24 4 1 18 89 1 1 1 1 1 29 22 1 80 32 36 6 1 63 1 30 1 1 1 86 79 73 52 9 1 1 11 7 1 25 20 1 20 1 49 1 37 1 41 1 1 1 1 54 55 1 10 1 1 1 1 1 1 66 1 68 1 1 1 1 53 1 1",
"output": "-1"
},
{
"input": "2\n1\n1 1\n1 1",
"output": "-1"
},
{
"input": "2\n1\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n1\n2 2\n1 1",
"output": "-1"
},
{
"input": "2\n1\n2 2\n2 2",
"output": "15.0000000000"
},
{
"input": "2\n2\n1 1\n1 1",
"output": "-1"
},
{
"input": "2\n2\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n2\n2 2\n1 1",
"output": "-1"
},
{
"input": "2\n2\n2 2\n2 2",
"output": "30.0000000000"
},
{
"input": "40\n55\n1 382 1 1 1 629 111 689 396 614 1 1 995 148 7 820 913 1 1 169 157 1 702 1 159 1 1 226 1 253 1 319 1 130 1 1 1 466 1 756\n1 23 555 1 412 1 1 373 316 234 888 1 112 818 33 443 313 1 235 1 1 610 110 535 1 445 1 386 1 1 758 1 292 1 862 1 244 428 530 1",
"output": "-1"
},
{
"input": "49\n1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "695580114.6380882263"
},
{
"input": "2\n12\n11 8\n1 1",
"output": "-1"
},
{
"input": "3\n3\n7 11 17\n19 31 33",
"output": "1.6012429470"
}
] | 1,532,681,423 | 2,147,483,647 | Python 3 | OK | TESTS | 76 | 124 | 0 | n = int(input())
m = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
ans = m
for i in range(n):
if b[-i] != 1:
e = ans/(b[-i]-1)
ans += e
if a[n-i-1] != 1:
e = ans/(a[n-i-1]-1)
ans += e
else:
print(-1)
exit()
else:
print(-1)
exit()
print(ans-m) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Natasha is going to fly on a rocket to Mars and return to Earth. Also, on the way to Mars, she will land on $n - 2$ intermediate planets. Formally: we number all the planets from $1$ to $n$. $1$ is Earth, $n$ is Mars. Natasha will make exactly $n$ flights: $1 \to 2 \to \ldots n \to 1$.
Flight from $x$ to $y$ consists of two phases: take-off from planet $x$ and landing to planet $y$. This way, the overall itinerary of the trip will be: the $1$-st planet $\to$ take-off from the $1$-st planet $\to$ landing to the $2$-nd planet $\to$ $2$-nd planet $\to$ take-off from the $2$-nd planet $\to$ $\ldots$ $\to$ landing to the $n$-th planet $\to$ the $n$-th planet $\to$ take-off from the $n$-th planet $\to$ landing to the $1$-st planet $\to$ the $1$-st planet.
The mass of the rocket together with all the useful cargo (but without fuel) is $m$ tons. However, Natasha does not know how much fuel to load into the rocket. Unfortunately, fuel can only be loaded on Earth, so if the rocket runs out of fuel on some other planet, Natasha will not be able to return home. Fuel is needed to take-off from each planet and to land to each planet. It is known that $1$ ton of fuel can lift off $a_i$ tons of rocket from the $i$-th planet or to land $b_i$ tons of rocket onto the $i$-th planet.
For example, if the weight of rocket is $9$ tons, weight of fuel is $3$ tons and take-off coefficient is $8$ ($a_i = 8$), then $1.5$ tons of fuel will be burnt (since $1.5 \cdot 8 = 9 + 3$). The new weight of fuel after take-off will be $1.5$ tons.
Please note, that it is allowed to burn non-integral amount of fuel during take-off or landing, and the amount of initial fuel can be non-integral as well.
Help Natasha to calculate the minimum mass of fuel to load into the rocket. Note, that the rocket must spend fuel to carry both useful cargo and the fuel itself. However, it doesn't need to carry the fuel which has already been burnt. Assume, that the rocket takes off and lands instantly.
Input Specification:
The first line contains a single integer $n$ ($2 \le n \le 1000$) — number of planets.
The second line contains the only integer $m$ ($1 \le m \le 1000$) — weight of the payload.
The third line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \le a_i \le 1000$), where $a_i$ is the number of tons, which can be lifted off by one ton of fuel.
The fourth line contains $n$ integers $b_1, b_2, \ldots, b_n$ ($1 \le b_i \le 1000$), where $b_i$ is the number of tons, which can be landed by one ton of fuel.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
Output Specification:
If Natasha can fly to Mars through $(n - 2)$ planets and return to Earth, print the minimum mass of fuel (in tons) that Natasha should take. Otherwise, print a single number $-1$.
It is guaranteed, that if Natasha can make a flight, then it takes no more than $10^9$ tons of fuel.
The answer will be considered correct if its absolute or relative error doesn't exceed $10^{-6}$. Formally, let your answer be $p$, and the jury's answer be $q$. Your answer is considered correct if $\frac{|p - q|}{\max{(1, |q|)}} \le 10^{-6}$.
Demo Input:
['2\n12\n11 8\n7 5\n', '3\n1\n1 4 1\n2 5 3\n', '6\n2\n4 6 3 3 5 6\n2 6 3 6 5 3\n']
Demo Output:
['10.0000000000\n', '-1\n', '85.4800000000\n']
Note:
Let's consider the first example.
Initially, the mass of a rocket with fuel is $22$ tons.
- At take-off from Earth one ton of fuel can lift off $11$ tons of cargo, so to lift off $22$ tons you need to burn $2$ tons of fuel. Remaining weight of the rocket with fuel is $20$ tons.- During landing on Mars, one ton of fuel can land $5$ tons of cargo, so for landing $20$ tons you will need to burn $4$ tons of fuel. There will be $16$ tons of the rocket with fuel remaining.- While taking off from Mars, one ton of fuel can raise $8$ tons of cargo, so to lift off $16$ tons you will need to burn $2$ tons of fuel. There will be $14$ tons of rocket with fuel after that.- During landing on Earth, one ton of fuel can land $7$ tons of cargo, so for landing $14$ tons you will need to burn $2$ tons of fuel. Remaining weight is $12$ tons, that is, a rocket without any fuel.
In the second case, the rocket will not be able even to take off from Earth. | ```python
n = int(input())
m = int(input())
a = list(map(int, input().split()))
b = list(map(int, input().split()))
ans = m
for i in range(n):
if b[-i] != 1:
e = ans/(b[-i]-1)
ans += e
if a[n-i-1] != 1:
e = ans/(a[n-i-1]-1)
ans += e
else:
print(-1)
exit()
else:
print(-1)
exit()
print(ans-m)
``` | 3 |
|
225 | C | Barcode | PROGRAMMING | 1,700 | [
"dp",
"matrices"
] | null | null | You've got an *n*<=×<=*m* pixel picture. Each pixel can be white or black. Your task is to change the colors of as few pixels as possible to obtain a barcode picture.
A picture is a barcode if the following conditions are fulfilled:
- All pixels in each column are of the same color. - The width of each monochrome vertical line is at least *x* and at most *y* pixels. In other words, if we group all neighbouring columns of the pixels with equal color, the size of each group can not be less than *x* or greater than *y*. | The first line contains four space-separated integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*,<=*x*,<=*y*<=≤<=1000; *x*<=≤<=*y*).
Then follow *n* lines, describing the original image. Each of these lines contains exactly *m* characters. Character "." represents a white pixel and "#" represents a black pixel. The picture description doesn't have any other characters besides "." and "#". | In the first line print the minimum number of pixels to repaint. It is guaranteed that the answer exists. | [
"6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..\n",
"2 5 1 1\n#####\n.....\n"
] | [
"11\n",
"5\n"
] | In the first test sample the picture after changing some colors can looks as follows:
In the second test sample the picture after changing some colors can looks as follows: | 1,500 | [
{
"input": "6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..",
"output": "11"
},
{
"input": "10 5 3 7\n.####\n###..\n##.##\n#..#.\n.#...\n#.##.\n.##..\n.#.##\n#.#..\n.#..#",
"output": "24"
},
{
"input": "6 3 1 4\n##.\n#..\n#..\n..#\n.#.\n#.#",
"output": "6"
},
{
"input": "5 10 4 16\n.#####....\n##..#..##.\n.#..##.#..\n##..#####.\n...#.##..#",
"output": "21"
},
{
"input": "5 4 1 4\n####\n..##\n##..\n..#.\n#..#",
"output": "8"
},
{
"input": "1 1 1 2\n.",
"output": "0"
},
{
"input": "3 44 2 18\n####..###.#.##........##...###.####.#.....##\n...#....##.###.###.##.#####.#######.#..#..#.\n#...#.####.#.##.#.#.#.....##.##..###.#....##",
"output": "39"
},
{
"input": "69 1 1 2\n#\n.\n#\n#\n.\n#\n#\n.\n.\n#\n.\n.\n#\n.\n#\n#\n.\n#\n#\n#\n#\n#\n.\n#\n.\n.\n#\n#\n#\n.\n.\n.\n.\n#\n#\n.\n#\n#\n.\n#\n.\n.\n#\n.\n.\n.\n#\n.\n.\n#\n#\n.\n.\n#\n.\n.\n.\n#\n#\n#\n#\n#\n.\n#\n.\n#\n#\n#\n#",
"output": "31"
},
{
"input": "56 2 2 2\n##\n##\n##\n..\n..\n##\n.#\n#.\n..\n##\n##\n..\n..\n#.\n#.\n#.\n#.\n##\n..\n.#\n..\n##\n##\n.#\n#.\n.#\n..\n..\n#.\n..\n##\n..\n#.\n.#\n#.\n#.\n#.\n##\n#.\n##\n##\n.#\n#.\n##\n..\n.#\n#.\n#.\n##\n..\n..\n#.\n##\n..\n..\n##",
"output": "55"
}
] | 1,596,313,014 | 2,147,483,647 | PyPy 3 | OK | TESTS | 36 | 1,184 | 110,592,000 | #!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Sat Aug 1 22:57:03 2020
@author: divyarth
"""
import sys
import heapq
import math
sys.setrecursionlimit(100000)
from collections import deque
from collections import defaultdict
from collections import Counter
#input=sys.stdin.readline
#print=sys.stdout.write
def PRINT(lst,sep=' '): print(sep.join(map(str,lst)))
I=lambda : list(map(int,input().split(' ')))
def solve():
return
n,m,x,y=I()
bar=[list(input()) for _ in range(n)]
def COL(k): return [bar[i][k] for i in range(n)]
row=[]
for i in range(m):
c=dict(Counter(COL(i)))
row.append(( c['#'] if '#' in c else 0))
s_arr=[0]
for r in row:
s_arr.append(s_arr[-1]+r)
def SUM(l,r):
return s_arr[r+1]-s_arr[l]
mem={}
import time
global arr
def rec(start,color):
if (start,color) in mem:
return mem[(start,color)]
elif start==m:
return 0
mm=float('inf')
for end in range(start+x-1,start+y):
if end>=m: continue
ss=SUM(start,end) if color=='b' else (end-start+1)*n-SUM(start,end)
#print(start,end,ss,(end-start+1)*n-ss)
mm=min(mm,ss+rec(end+1,'w' if color=='b' else 'b'))
mem[(start,color)]=mm
return mm
print(min(rec(0,'w'),rec(0,'b'))) | Title: Barcode
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got an *n*<=×<=*m* pixel picture. Each pixel can be white or black. Your task is to change the colors of as few pixels as possible to obtain a barcode picture.
A picture is a barcode if the following conditions are fulfilled:
- All pixels in each column are of the same color. - The width of each monochrome vertical line is at least *x* and at most *y* pixels. In other words, if we group all neighbouring columns of the pixels with equal color, the size of each group can not be less than *x* or greater than *y*.
Input Specification:
The first line contains four space-separated integers *n*, *m*, *x* and *y* (1<=≤<=*n*,<=*m*,<=*x*,<=*y*<=≤<=1000; *x*<=≤<=*y*).
Then follow *n* lines, describing the original image. Each of these lines contains exactly *m* characters. Character "." represents a white pixel and "#" represents a black pixel. The picture description doesn't have any other characters besides "." and "#".
Output Specification:
In the first line print the minimum number of pixels to repaint. It is guaranteed that the answer exists.
Demo Input:
['6 5 1 2\n##.#.\n.###.\n###..\n#...#\n.##.#\n###..\n', '2 5 1 1\n#####\n.....\n']
Demo Output:
['11\n', '5\n']
Note:
In the first test sample the picture after changing some colors can looks as follows:
In the second test sample the picture after changing some colors can looks as follows: | ```python
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Sat Aug 1 22:57:03 2020
@author: divyarth
"""
import sys
import heapq
import math
sys.setrecursionlimit(100000)
from collections import deque
from collections import defaultdict
from collections import Counter
#input=sys.stdin.readline
#print=sys.stdout.write
def PRINT(lst,sep=' '): print(sep.join(map(str,lst)))
I=lambda : list(map(int,input().split(' ')))
def solve():
return
n,m,x,y=I()
bar=[list(input()) for _ in range(n)]
def COL(k): return [bar[i][k] for i in range(n)]
row=[]
for i in range(m):
c=dict(Counter(COL(i)))
row.append(( c['#'] if '#' in c else 0))
s_arr=[0]
for r in row:
s_arr.append(s_arr[-1]+r)
def SUM(l,r):
return s_arr[r+1]-s_arr[l]
mem={}
import time
global arr
def rec(start,color):
if (start,color) in mem:
return mem[(start,color)]
elif start==m:
return 0
mm=float('inf')
for end in range(start+x-1,start+y):
if end>=m: continue
ss=SUM(start,end) if color=='b' else (end-start+1)*n-SUM(start,end)
#print(start,end,ss,(end-start+1)*n-ss)
mm=min(mm,ss+rec(end+1,'w' if color=='b' else 'b'))
mem[(start,color)]=mm
return mm
print(min(rec(0,'w'),rec(0,'b')))
``` | 3 |
|
199 | A | Hexadecimal's theorem | PROGRAMMING | 900 | [
"brute force",
"constructive algorithms",
"implementation",
"number theory"
] | null | null | Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible. | The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number. | Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them. | [
"3\n",
"13\n"
] | [
"1 1 1\n",
"2 3 8\n"
] | none | 500 | [
{
"input": "3",
"output": "1 1 1"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "3",
"output": "1 1 1"
},
{
"input": "5",
"output": "1 1 3"
},
{
"input": "8",
"output": "1 2 5"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "21",
"output": "3 5 13"
},
{
"input": "34",
"output": "5 8 21"
},
{
"input": "55",
"output": "8 13 34"
},
{
"input": "89",
"output": "13 21 55"
},
{
"input": "144",
"output": "21 34 89"
},
{
"input": "233",
"output": "34 55 144"
},
{
"input": "377",
"output": "55 89 233"
},
{
"input": "610",
"output": "89 144 377"
},
{
"input": "987",
"output": "144 233 610"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "2584",
"output": "377 610 1597"
},
{
"input": "4181",
"output": "610 987 2584"
},
{
"input": "6765",
"output": "987 1597 4181"
},
{
"input": "10946",
"output": "1597 2584 6765"
},
{
"input": "17711",
"output": "2584 4181 10946"
},
{
"input": "28657",
"output": "4181 6765 17711"
},
{
"input": "46368",
"output": "6765 10946 28657"
},
{
"input": "75025",
"output": "10946 17711 46368"
},
{
"input": "121393",
"output": "17711 28657 75025"
},
{
"input": "196418",
"output": "28657 46368 121393"
},
{
"input": "317811",
"output": "46368 75025 196418"
},
{
"input": "514229",
"output": "75025 121393 317811"
},
{
"input": "832040",
"output": "121393 196418 514229"
},
{
"input": "1346269",
"output": "196418 317811 832040"
},
{
"input": "2178309",
"output": "317811 514229 1346269"
},
{
"input": "3524578",
"output": "514229 832040 2178309"
},
{
"input": "5702887",
"output": "832040 1346269 3524578"
},
{
"input": "9227465",
"output": "1346269 2178309 5702887"
},
{
"input": "14930352",
"output": "2178309 3524578 9227465"
},
{
"input": "24157817",
"output": "3524578 5702887 14930352"
},
{
"input": "39088169",
"output": "5702887 9227465 24157817"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "165580141",
"output": "24157817 39088169 102334155"
},
{
"input": "267914296",
"output": "39088169 63245986 165580141"
},
{
"input": "433494437",
"output": "63245986 102334155 267914296"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
}
] | 1,670,922,268 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 54 | 124 | 0 | def Hexadecimals_theorem():
def create_fibonacci(max_element):
prev = 0
cur = 1
fibonacci_sequence = []
fibonacci_sequence.append(prev)
fibonacci_sequence.append(cur)
while cur < max_element:
new = prev + cur
fibonacci_sequence.append(new)
prev = cur
cur = new
return fibonacci_sequence
fibonacci_number = int(input())
fibonacci_sequence = create_fibonacci(fibonacci_number)
length = len(fibonacci_sequence)
#print(fibonacci_sequence)
if len(fibonacci_sequence) >= 5:
print("{} {} {}".format(fibonacci_sequence[length-5],fibonacci_sequence[length-4], fibonacci_sequence[length-2]))
else:
required_numbers = []
for i in range(fibonacci_number):
required_numbers.append(1)
while len(required_numbers) != 3:
required_numbers.append(0)
print("{} {} {}".format(required_numbers[0],required_numbers[1], required_numbers[2]))
Hexadecimals_theorem() | Title: Hexadecimal's theorem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
Input Specification:
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output Specification:
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '13\n']
Demo Output:
['1 1 1\n', '2 3 8\n']
Note:
none | ```python
def Hexadecimals_theorem():
def create_fibonacci(max_element):
prev = 0
cur = 1
fibonacci_sequence = []
fibonacci_sequence.append(prev)
fibonacci_sequence.append(cur)
while cur < max_element:
new = prev + cur
fibonacci_sequence.append(new)
prev = cur
cur = new
return fibonacci_sequence
fibonacci_number = int(input())
fibonacci_sequence = create_fibonacci(fibonacci_number)
length = len(fibonacci_sequence)
#print(fibonacci_sequence)
if len(fibonacci_sequence) >= 5:
print("{} {} {}".format(fibonacci_sequence[length-5],fibonacci_sequence[length-4], fibonacci_sequence[length-2]))
else:
required_numbers = []
for i in range(fibonacci_number):
required_numbers.append(1)
while len(required_numbers) != 3:
required_numbers.append(0)
print("{} {} {}".format(required_numbers[0],required_numbers[1], required_numbers[2]))
Hexadecimals_theorem()
``` | 3 |
|
980 | B | Marlin | PROGRAMMING | 1,600 | [
"constructive algorithms"
] | null | null | The city of Fishtopia can be imagined as a grid of $4$ rows and an odd number of columns. It has two main villages; the first is located at the top-left cell $(1,1)$, people who stay there love fishing at the Tuna pond at the bottom-right cell $(4, n)$. The second village is located at $(4, 1)$ and its people love the Salmon pond at $(1, n)$.
The mayor of Fishtopia wants to place $k$ hotels in the city, each one occupying one cell. To allow people to enter the city from anywhere, hotels should not be placed on the border cells.
A person can move from one cell to another if those cells are not occupied by hotels and share a side.
Can you help the mayor place the hotels in a way such that there are equal number of shortest paths from each village to its preferred pond? | The first line of input contain two integers, $n$ and $k$ ($3 \leq n \leq 99$, $0 \leq k \leq 2\times(n-2)$), $n$ is odd, the width of the city, and the number of hotels to be placed, respectively. | Print "YES", if it is possible to place all the hotels in a way that satisfies the problem statement, otherwise print "NO".
If it is possible, print an extra $4$ lines that describe the city, each line should have $n$ characters, each of which is "#" if that cell has a hotel on it, or "." if not. | [
"7 2\n",
"5 3\n"
] | [
"YES\n.......\n.#.....\n.#.....\n.......\n",
"YES\n.....\n.###.\n.....\n.....\n"
] | none | 1,000 | [
{
"input": "7 2",
"output": "YES\n.......\n.#.....\n.#.....\n......."
},
{
"input": "5 3",
"output": "YES\n.....\n.###.\n.....\n....."
},
{
"input": "3 2",
"output": "YES\n...\n.#.\n.#.\n..."
},
{
"input": "3 0",
"output": "YES\n...\n...\n...\n..."
},
{
"input": "49 1",
"output": "YES\n.................................................\n........................#........................\n.................................................\n................................................."
},
{
"input": "9 4",
"output": "YES\n.........\n.##......\n.##......\n........."
},
{
"input": "9 5",
"output": "YES\n.........\n.#.#.....\n.###.....\n........."
},
{
"input": "99 193",
"output": "YES\n...................................................................................................\n.###############################################################################################.#.\n.#################################################################################################.\n..................................................................................................."
},
{
"input": "99 14",
"output": "YES\n...................................................................................................\n.#######...........................................................................................\n.#######...........................................................................................\n..................................................................................................."
},
{
"input": "57 15",
"output": "YES\n.........................................................\n.######.#................................................\n.########................................................\n........................................................."
},
{
"input": "99 3",
"output": "YES\n...................................................................................................\n................................................###................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "3 1",
"output": "YES\n...\n.#.\n...\n..."
},
{
"input": "9 9",
"output": "YES\n.........\n.###.#...\n.#####...\n........."
},
{
"input": "67 9",
"output": "YES\n...................................................................\n.###.#.............................................................\n.#####.............................................................\n..................................................................."
},
{
"input": "99 99",
"output": "YES\n...................................................................................................\n.################################################.#................................................\n.##################################################................................................\n..................................................................................................."
},
{
"input": "31 32",
"output": "YES\n...............................\n.################..............\n.################..............\n..............................."
},
{
"input": "5 1",
"output": "YES\n.....\n..#..\n.....\n....."
},
{
"input": "5 2",
"output": "YES\n.....\n.#...\n.#...\n....."
},
{
"input": "5 4",
"output": "YES\n.....\n.##..\n.##..\n....."
},
{
"input": "5 6",
"output": "YES\n.....\n.###.\n.###.\n....."
},
{
"input": "5 5",
"output": "YES\n.....\n.#.#.\n.###.\n....."
},
{
"input": "7 9",
"output": "YES\n.......\n.###.#.\n.#####.\n......."
},
{
"input": "7 10",
"output": "YES\n.......\n.#####.\n.#####.\n......."
},
{
"input": "19 12",
"output": "YES\n...................\n.######............\n.######............\n..................."
},
{
"input": "19 3",
"output": "YES\n...................\n........###........\n...................\n..................."
},
{
"input": "37 14",
"output": "YES\n.....................................\n.#######.............................\n.#######.............................\n....................................."
},
{
"input": "37 15",
"output": "YES\n.....................................\n.######.#............................\n.########............................\n....................................."
},
{
"input": "37 37",
"output": "YES\n.....................................\n.#################.#.................\n.###################.................\n....................................."
},
{
"input": "37 36",
"output": "YES\n.....................................\n.##################..................\n.##################..................\n....................................."
},
{
"input": "37 35",
"output": "YES\n.....................................\n.################.#..................\n.##################..................\n....................................."
},
{
"input": "37 34",
"output": "YES\n.....................................\n.#################...................\n.#################...................\n....................................."
},
{
"input": "37 38",
"output": "YES\n.....................................\n.###################.................\n.###################.................\n....................................."
},
{
"input": "37 39",
"output": "YES\n.....................................\n.##################.#................\n.####################................\n....................................."
},
{
"input": "37 40",
"output": "YES\n.....................................\n.####################................\n.####################................\n....................................."
},
{
"input": "5 0",
"output": "YES\n.....\n.....\n.....\n....."
},
{
"input": "67 1",
"output": "YES\n...................................................................\n.................................#.................................\n...................................................................\n..................................................................."
},
{
"input": "37 19",
"output": "YES\n.....................................\n.########.#..........................\n.##########..........................\n....................................."
},
{
"input": "77 7",
"output": "YES\n.............................................................................\n.##.#........................................................................\n.####........................................................................\n............................................................................."
},
{
"input": "33 47",
"output": "YES\n.................................\n.######################.#........\n.########################........\n................................."
},
{
"input": "33 48",
"output": "YES\n.................................\n.########################........\n.########################........\n................................."
},
{
"input": "23 40",
"output": "YES\n.......................\n.####################..\n.####################..\n......................."
},
{
"input": "23 39",
"output": "YES\n.......................\n.##################.#..\n.####################..\n......................."
},
{
"input": "49 3",
"output": "YES\n.................................................\n.......................###.......................\n.................................................\n................................................."
},
{
"input": "99 1",
"output": "YES\n...................................................................................................\n.................................................#.................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "77 0",
"output": "YES\n.............................................................................\n.............................................................................\n.............................................................................\n............................................................................."
},
{
"input": "99 0",
"output": "YES\n...................................................................................................\n...................................................................................................\n...................................................................................................\n..................................................................................................."
},
{
"input": "99 5",
"output": "YES\n...................................................................................................\n.#.#...............................................................................................\n.###...............................................................................................\n..................................................................................................."
},
{
"input": "99 4",
"output": "YES\n...................................................................................................\n.##................................................................................................\n.##................................................................................................\n..................................................................................................."
},
{
"input": "99 20",
"output": "YES\n...................................................................................................\n.##########........................................................................................\n.##########........................................................................................\n..................................................................................................."
},
{
"input": "99 194",
"output": "YES\n...................................................................................................\n.#################################################################################################.\n.#################################################################################################.\n..................................................................................................."
},
{
"input": "99 192",
"output": "YES\n...................................................................................................\n.################################################################################################..\n.################################################################################################..\n..................................................................................................."
},
{
"input": "99 190",
"output": "YES\n...................................................................................................\n.###############################################################################################...\n.###############################################################################################...\n..................................................................................................."
},
{
"input": "99 189",
"output": "YES\n...................................................................................................\n.#############################################################################################.#...\n.###############################################################################################...\n..................................................................................................."
},
{
"input": "99 177",
"output": "YES\n...................................................................................................\n.#######################################################################################.#.........\n.#########################################################################################.........\n..................................................................................................."
},
{
"input": "99 154",
"output": "YES\n...................................................................................................\n.#############################################################################.....................\n.#############################################################################.....................\n..................................................................................................."
},
{
"input": "99 127",
"output": "YES\n...................................................................................................\n.##############################################################.#..................................\n.################################################################..................................\n..................................................................................................."
},
{
"input": "99 55",
"output": "YES\n...................................................................................................\n.##########################.#......................................................................\n.############################......................................................................\n..................................................................................................."
},
{
"input": "99 40",
"output": "YES\n...................................................................................................\n.####################..............................................................................\n.####################..............................................................................\n..................................................................................................."
},
{
"input": "97 190",
"output": "YES\n.................................................................................................\n.###############################################################################################.\n.###############################################################################################.\n................................................................................................."
},
{
"input": "97 100",
"output": "YES\n.................................................................................................\n.##################################################..............................................\n.##################################################..............................................\n................................................................................................."
},
{
"input": "97 111",
"output": "YES\n.................................................................................................\n.######################################################.#........................................\n.########################################################........................................\n................................................................................................."
},
{
"input": "97 64",
"output": "YES\n.................................................................................................\n.################################................................................................\n.################################................................................................\n................................................................................................."
},
{
"input": "97 77",
"output": "YES\n.................................................................................................\n.#####################################.#.........................................................\n.#######################################.........................................................\n................................................................................................."
},
{
"input": "91 77",
"output": "YES\n...........................................................................................\n.#####################################.#...................................................\n.#######################################...................................................\n..........................................................................................."
},
{
"input": "91 128",
"output": "YES\n...........................................................................................\n.################################################################..........................\n.################################################################..........................\n..........................................................................................."
},
{
"input": "91 113",
"output": "YES\n...........................................................................................\n.#######################################################.#.................................\n.#########################################################.................................\n..........................................................................................."
},
{
"input": "55 55",
"output": "YES\n.......................................................\n.##########################.#..........................\n.############################..........................\n......................................................."
},
{
"input": "43 34",
"output": "YES\n...........................................\n.#################.........................\n.#################.........................\n..........................................."
},
{
"input": "13 21",
"output": "YES\n.............\n.#########.#.\n.###########.\n............."
},
{
"input": "27 50",
"output": "YES\n...........................\n.#########################.\n.#########################.\n..........................."
},
{
"input": "27 49",
"output": "YES\n...........................\n.#######################.#.\n.#########################.\n..........................."
},
{
"input": "27 48",
"output": "YES\n...........................\n.########################..\n.########################..\n..........................."
},
{
"input": "27 40",
"output": "YES\n...........................\n.####################......\n.####################......\n..........................."
},
{
"input": "87 80",
"output": "YES\n.......................................................................................\n.########################################..............................................\n.########################################..............................................\n......................................................................................."
},
{
"input": "69 17",
"output": "YES\n.....................................................................\n.#######.#...........................................................\n.#########...........................................................\n....................................................................."
},
{
"input": "39 73",
"output": "YES\n.......................................\n.###################################.#.\n.#####################################.\n......................................."
},
{
"input": "39 72",
"output": "YES\n.......................................\n.####################################..\n.####################################..\n......................................."
},
{
"input": "33 57",
"output": "YES\n.................................\n.###########################.#...\n.#############################...\n................................."
},
{
"input": "33 54",
"output": "YES\n.................................\n.###########################.....\n.###########################.....\n................................."
},
{
"input": "99 2",
"output": "YES\n...................................................................................................\n.#.................................................................................................\n.#.................................................................................................\n..................................................................................................."
},
{
"input": "99 7",
"output": "YES\n...................................................................................................\n.##.#..............................................................................................\n.####..............................................................................................\n..................................................................................................."
},
{
"input": "99 37",
"output": "YES\n...................................................................................................\n.#################.#...............................................................................\n.###################...............................................................................\n..................................................................................................."
},
{
"input": "57 67",
"output": "YES\n.........................................................\n.################################.#......................\n.##################################......................\n........................................................."
},
{
"input": "57 34",
"output": "YES\n.........................................................\n.#################.......................................\n.#################.......................................\n........................................................."
},
{
"input": "73 17",
"output": "YES\n.........................................................................\n.#######.#...............................................................\n.#########...............................................................\n........................................................................."
},
{
"input": "73 43",
"output": "YES\n.........................................................................\n.####################.#..................................................\n.######################..................................................\n........................................................................."
},
{
"input": "7 3",
"output": "YES\n.......\n..###..\n.......\n......."
},
{
"input": "7 7",
"output": "YES\n.......\n.##.#..\n.####..\n......."
}
] | 1,581,494,019 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 108 | 307,200 | from bisect import bisect_left, bisect_right
def tuple_input(type):
return map(type, input().strip().split())
def print_list(s):
print(''.join(map(str, s)))
'''
'''
n, k = tuple_input(int)
res = list()
for i in range(4):
res.append(['.'] * n)
if k % 2 == 0:
for i in range(1, 3):
for j in range(k // 2):
res[i][j] = '#'
else:
i = 0
j = n // 2
res[i][j] = '#'
k -= 1
if k > 0:
i += 1
res[i][j] = '#'
i += 1
res[i][j] = '#'
k -= 2
i = 0
j -= 1
d = 2
while k > 0:
res[i][j] = '#'
res[i][j + d] = '#'
k -= 2
i += 1
if i == 3:
i = 0
j -= 1
d += 2
print('YES')
for e in res:
print(''.join(e)) | Title: Marlin
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The city of Fishtopia can be imagined as a grid of $4$ rows and an odd number of columns. It has two main villages; the first is located at the top-left cell $(1,1)$, people who stay there love fishing at the Tuna pond at the bottom-right cell $(4, n)$. The second village is located at $(4, 1)$ and its people love the Salmon pond at $(1, n)$.
The mayor of Fishtopia wants to place $k$ hotels in the city, each one occupying one cell. To allow people to enter the city from anywhere, hotels should not be placed on the border cells.
A person can move from one cell to another if those cells are not occupied by hotels and share a side.
Can you help the mayor place the hotels in a way such that there are equal number of shortest paths from each village to its preferred pond?
Input Specification:
The first line of input contain two integers, $n$ and $k$ ($3 \leq n \leq 99$, $0 \leq k \leq 2\times(n-2)$), $n$ is odd, the width of the city, and the number of hotels to be placed, respectively.
Output Specification:
Print "YES", if it is possible to place all the hotels in a way that satisfies the problem statement, otherwise print "NO".
If it is possible, print an extra $4$ lines that describe the city, each line should have $n$ characters, each of which is "#" if that cell has a hotel on it, or "." if not.
Demo Input:
['7 2\n', '5 3\n']
Demo Output:
['YES\n.......\n.#.....\n.#.....\n.......\n', 'YES\n.....\n.###.\n.....\n.....\n']
Note:
none | ```python
from bisect import bisect_left, bisect_right
def tuple_input(type):
return map(type, input().strip().split())
def print_list(s):
print(''.join(map(str, s)))
'''
'''
n, k = tuple_input(int)
res = list()
for i in range(4):
res.append(['.'] * n)
if k % 2 == 0:
for i in range(1, 3):
for j in range(k // 2):
res[i][j] = '#'
else:
i = 0
j = n // 2
res[i][j] = '#'
k -= 1
if k > 0:
i += 1
res[i][j] = '#'
i += 1
res[i][j] = '#'
k -= 2
i = 0
j -= 1
d = 2
while k > 0:
res[i][j] = '#'
res[i][j + d] = '#'
k -= 2
i += 1
if i == 3:
i = 0
j -= 1
d += 2
print('YES')
for e in res:
print(''.join(e))
``` | 0 |
|
570 | B | Simple Game | PROGRAMMING | 1,300 | [
"constructive algorithms",
"games",
"greedy",
"implementation",
"math"
] | null | null | One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive). | The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively. | Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them. | [
"3 1\n",
"4 3\n"
] | [
"2",
"2"
] | In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less. | 1,000 | [
{
"input": "3 1",
"output": "2"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "10 5",
"output": "6"
},
{
"input": "20 13",
"output": "12"
},
{
"input": "51 1",
"output": "2"
},
{
"input": "100 50",
"output": "51"
},
{
"input": "100 51",
"output": "50"
},
{
"input": "100 49",
"output": "50"
},
{
"input": "1000000000 1000000000",
"output": "999999999"
},
{
"input": "1000000000 1",
"output": "2"
},
{
"input": "1000000000 100000000",
"output": "100000001"
},
{
"input": "1000000000 500000000",
"output": "500000001"
},
{
"input": "1000000000 123124",
"output": "123125"
},
{
"input": "12412523 125123",
"output": "125124"
},
{
"input": "54645723 432423",
"output": "432424"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "262833325 131416663",
"output": "131416662"
},
{
"input": "477667530 238833766",
"output": "238833765"
},
{
"input": "692501734 346250868",
"output": "346250867"
},
{
"input": "907335939 453667970",
"output": "453667969"
},
{
"input": "746085224 373042613",
"output": "373042612"
},
{
"input": "189520699 94760350",
"output": "94760349"
},
{
"input": "404354904 202177453",
"output": "202177452"
},
{
"input": "619189108 309594555",
"output": "309594554"
},
{
"input": "81813292 40906647",
"output": "40906646"
},
{
"input": "296647497 148323750",
"output": "148323749"
},
{
"input": "511481701 255740851",
"output": "255740850"
},
{
"input": "726315905 363157953",
"output": "363157952"
},
{
"input": "496110970 201868357",
"output": "201868358"
},
{
"input": "710945175 173165570",
"output": "173165571"
},
{
"input": "925779379 720443954",
"output": "720443953"
},
{
"input": "140613583 93171580",
"output": "93171579"
},
{
"input": "355447788 85890184",
"output": "85890185"
},
{
"input": "570281992 291648263",
"output": "291648262"
},
{
"input": "541904957 459371829",
"output": "459371828"
},
{
"input": "756739161 125332525",
"output": "125332526"
},
{
"input": "971573366 216791157",
"output": "216791158"
},
{
"input": "186407570 160453970",
"output": "160453969"
},
{
"input": "401241775 170032078",
"output": "170032079"
},
{
"input": "616075979 207073797",
"output": "207073798"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "3 1",
"output": "2"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "4 1",
"output": "2"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "4 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "5 1",
"output": "2"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "5 3",
"output": "2"
},
{
"input": "5 4",
"output": "3"
},
{
"input": "5 5",
"output": "4"
},
{
"input": "3 2",
"output": "1"
},
{
"input": "7 4",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "7 3",
"output": "4"
}
] | 1,697,421,245 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | n, m = map(int, input().split())
if n % 2 == 0:
choice = n // 2
else:
choice = n // 2
if choice == m:
choice += 1
print(choice) | Title: Simple Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Misha and Andrew were playing a very simple game. First, each player chooses an integer in the range from 1 to *n*. Let's assume that Misha chose number *m*, and Andrew chose number *a*.
Then, by using a random generator they choose a random integer *c* in the range between 1 and *n* (any integer from 1 to *n* is chosen with the same probability), after which the winner is the player, whose number was closer to *c*. The boys agreed that if *m* and *a* are located on the same distance from *c*, Misha wins.
Andrew wants to win very much, so he asks you to help him. You know the number selected by Misha, and number *n*. You need to determine which value of *a* Andrew must choose, so that the probability of his victory is the highest possible.
More formally, you need to find such integer *a* (1<=≤<=*a*<=≤<=*n*), that the probability that is maximal, where *c* is the equiprobably chosen integer from 1 to *n* (inclusive).
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the range of numbers in the game, and the number selected by Misha respectively.
Output Specification:
Print a single number — such value *a*, that probability that Andrew wins is the highest. If there are multiple such values, print the minimum of them.
Demo Input:
['3 1\n', '4 3\n']
Demo Output:
['2', '2']
Note:
In the first sample test: Andrew wins if *c* is equal to 2 or 3. The probability that Andrew wins is 2 / 3. If Andrew chooses *a* = 3, the probability of winning will be 1 / 3. If *a* = 1, the probability of winning is 0.
In the second sample test: Andrew wins if *c* is equal to 1 and 2. The probability that Andrew wins is 1 / 2. For other choices of *a* the probability of winning is less. | ```python
n, m = map(int, input().split())
if n % 2 == 0:
choice = n // 2
else:
choice = n // 2
if choice == m:
choice += 1
print(choice)
``` | 0 |
|
119 | A | Epic Game | PROGRAMMING | 800 | [
"implementation"
] | null | null | Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game. | The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile. | If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes). | [
"3 5 9\n",
"1 1 100\n"
] | [
"0",
"1"
] | The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that. | 500 | [
{
"input": "3 5 9",
"output": "0"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "23 12 16",
"output": "1"
},
{
"input": "95 26 29",
"output": "1"
},
{
"input": "73 32 99",
"output": "1"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "41 12 65",
"output": "1"
},
{
"input": "13 61 100",
"output": "1"
},
{
"input": "100 100 10",
"output": "0"
},
{
"input": "12 24 26",
"output": "1"
},
{
"input": "73 21 96",
"output": "1"
},
{
"input": "17 22 81",
"output": "1"
},
{
"input": "14 88 97",
"output": "1"
},
{
"input": "42 81 17",
"output": "0"
},
{
"input": "34 36 19",
"output": "1"
},
{
"input": "21 87 12",
"output": "1"
},
{
"input": "97 92 98",
"output": "1"
},
{
"input": "49 25 62",
"output": "1"
},
{
"input": "29 17 44",
"output": "1"
},
{
"input": "10 1 10",
"output": "0"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "100 100 1",
"output": "0"
},
{
"input": "11 99 55",
"output": "0"
},
{
"input": "8 13 21",
"output": "0"
},
{
"input": "34 55 89",
"output": "0"
},
{
"input": "21 34 55",
"output": "1"
},
{
"input": "13 21 34",
"output": "1"
},
{
"input": "34 21 55",
"output": "0"
},
{
"input": "10 20 84",
"output": "1"
},
{
"input": "4 2 5",
"output": "0"
},
{
"input": "3 2 3",
"output": "0"
},
{
"input": "31 23 1",
"output": "0"
},
{
"input": "100 100 100",
"output": "0"
},
{
"input": "100 1 100",
"output": "0"
},
{
"input": "1 100 100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "17 23 100",
"output": "1"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "1 1 2",
"output": "1"
},
{
"input": "2 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "2 1 2",
"output": "0"
},
{
"input": "10 10 3",
"output": "1"
},
{
"input": "2 2 1",
"output": "0"
},
{
"input": "9 5 1",
"output": "0"
}
] | 1,602,756,451 | 2,147,483,647 | Python 3 | OK | TESTS | 45 | 218 | 307,200 | def gsd(a, b):
if b == 0:
return a
else:
return gsd(b, a % b)
list1 = [int(x) for x in input().split(' ')]
stone = 1e12
while 1:
#print(list1[0], list1[1], list1[2])
if list1[2] - gsd(list1[0], list1[2]) >= 0:
list1[2] -= gsd(list1[0], list1[2])
else:
print(1)
break
#print(list1[0], list1[1], list1[2])
if list1[2] >= gsd(list1[1], list1[2]):
list1[2] -= gsd(list1[1], list1[2])
else:
print(0)
break
| Title: Epic Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
Input Specification:
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
Output Specification:
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
Demo Input:
['3 5 9\n', '1 1 100\n']
Demo Output:
['0', '1']
Note:
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that. | ```python
def gsd(a, b):
if b == 0:
return a
else:
return gsd(b, a % b)
list1 = [int(x) for x in input().split(' ')]
stone = 1e12
while 1:
#print(list1[0], list1[1], list1[2])
if list1[2] - gsd(list1[0], list1[2]) >= 0:
list1[2] -= gsd(list1[0], list1[2])
else:
print(1)
break
#print(list1[0], list1[1], list1[2])
if list1[2] >= gsd(list1[1], list1[2]):
list1[2] -= gsd(list1[1], list1[2])
else:
print(0)
break
``` | 3 |
|
637 | B | Chat Order | PROGRAMMING | 1,200 | [
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
] | null | null | Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus. | The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10. | Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom. | [
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
] | [
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
] | In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | 1,000 | [
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
] | 1,626,855,572 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 3,000 | 25,497,600 | n = int(input())
l=[[x for x in input().split()] for i in range(n)]
l.reverse()
l_2 = []
for i in range(n):
s = l.pop()
if s not in l_2 :
l_2.append(s)
else:
l_2.remove(s)
l_2.append(s)
l_2.reverse()
for i in l_2:
print(*i) | Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex | ```python
n = int(input())
l=[[x for x in input().split()] for i in range(n)]
l.reverse()
l_2 = []
for i in range(n):
s = l.pop()
if s not in l_2 :
l_2.append(s)
else:
l_2.remove(s)
l_2.append(s)
l_2.reverse()
for i in l_2:
print(*i)
``` | 0 |
|
664 | A | Complicated GCD | PROGRAMMING | 800 | [
"math",
"number theory"
] | null | null | Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). | Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. | [
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] | [
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] | none | 500 | [
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,635,255,030 | 2,147,483,647 | PyPy 3 | OK | TESTS | 28 | 78 | 17,715,200 | first = input()
first, second = first.split(' ')
if first == second:
print(first)
else:
print(1) | Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none | ```python
first = input()
first, second = first.split(' ')
if first == second:
print(first)
else:
print(1)
``` | 3 |
|
742 | A | Arpa’s hard exam and Mehrdad’s naive cheat | PROGRAMMING | 1,000 | [
"implementation",
"math",
"number theory"
] | null | null | There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat. | The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109). | Print single integer — the last digit of 1378*n*. | [
"1\n",
"2\n"
] | [
"8",
"4"
] | In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4. | 500 | [
{
"input": "1",
"output": "8"
},
{
"input": "2",
"output": "4"
},
{
"input": "1000",
"output": "6"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "6"
},
{
"input": "1000000000",
"output": "6"
},
{
"input": "5",
"output": "8"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "2"
},
{
"input": "1378",
"output": "4"
},
{
"input": "13781378",
"output": "4"
},
{
"input": "51202278",
"output": "4"
},
{
"input": "999999998",
"output": "4"
},
{
"input": "999999997",
"output": "8"
},
{
"input": "12193721",
"output": "8"
},
{
"input": "0",
"output": "1"
},
{
"input": "989898989",
"output": "8"
},
{
"input": "7",
"output": "2"
},
{
"input": "8",
"output": "6"
},
{
"input": "9",
"output": "8"
},
{
"input": "10",
"output": "4"
},
{
"input": "11",
"output": "2"
},
{
"input": "12",
"output": "6"
},
{
"input": "13",
"output": "8"
},
{
"input": "14",
"output": "4"
},
{
"input": "15",
"output": "2"
},
{
"input": "16",
"output": "6"
},
{
"input": "999999996",
"output": "6"
},
{
"input": "999999995",
"output": "2"
},
{
"input": "999999994",
"output": "4"
}
] | 1,670,572,488 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 1,000 | 24,985,600 | s = f"{pow(1378,int(input()))}"
print(s[len(s)-1]) | Title: Arpa’s hard exam and Mehrdad’s naive cheat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
Input Specification:
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Output Specification:
Print single integer — the last digit of 1378*n*.
Demo Input:
['1\n', '2\n']
Demo Output:
['8', '4']
Note:
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4. | ```python
s = f"{pow(1378,int(input()))}"
print(s[len(s)-1])
``` | 0 |
|
228 | A | Is your horseshoe on the other hoof? | PROGRAMMING | 800 | [
"implementation"
] | null | null | Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. | The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers. | Print a single integer — the minimum number of horseshoes Valera needs to buy. | [
"1 7 3 3\n",
"7 7 7 7\n"
] | [
"1\n",
"3\n"
] | none | 500 | [
{
"input": "1 7 3 3",
"output": "1"
},
{
"input": "7 7 7 7",
"output": "3"
},
{
"input": "81170865 673572653 756938629 995577259",
"output": "0"
},
{
"input": "3491663 217797045 522540872 715355328",
"output": "0"
},
{
"input": "251590420 586975278 916631563 586975278",
"output": "1"
},
{
"input": "259504825 377489979 588153796 377489979",
"output": "1"
},
{
"input": "652588203 931100304 931100304 652588203",
"output": "2"
},
{
"input": "391958720 651507265 391958720 651507265",
"output": "2"
},
{
"input": "90793237 90793237 90793237 90793237",
"output": "3"
},
{
"input": "551651653 551651653 551651653 551651653",
"output": "3"
},
{
"input": "156630260 609654355 668943582 973622757",
"output": "0"
},
{
"input": "17061017 110313588 434481173 796661222",
"output": "0"
},
{
"input": "24975422 256716298 337790533 690960249",
"output": "0"
},
{
"input": "255635360 732742923 798648949 883146723",
"output": "0"
},
{
"input": "133315691 265159773 734556507 265159773",
"output": "1"
},
{
"input": "28442865 741657755 978106882 978106882",
"output": "1"
},
{
"input": "131245479 174845575 497483467 131245479",
"output": "1"
},
{
"input": "139159884 616215581 958341883 616215581",
"output": "1"
},
{
"input": "147784432 947653080 947653080 947653080",
"output": "2"
},
{
"input": "94055790 756126496 756126496 94055790",
"output": "2"
},
{
"input": "240458500 511952208 240458500 511952208",
"output": "2"
},
{
"input": "681828506 972810624 972810624 681828506",
"output": "2"
},
{
"input": "454961014 454961014 454961014 454961014",
"output": "3"
},
{
"input": "915819430 915819430 915819430 915819430",
"output": "3"
},
{
"input": "671645142 671645142 671645142 671645142",
"output": "3"
},
{
"input": "132503558 132503558 132503558 132503558",
"output": "3"
},
{
"input": "5 5 999999 6",
"output": "1"
},
{
"input": "1 1 2 5",
"output": "1"
},
{
"input": "2 1 2 3",
"output": "1"
},
{
"input": "1 1 3 5",
"output": "1"
},
{
"input": "1 1 3 3",
"output": "2"
},
{
"input": "2 2 2 1",
"output": "2"
},
{
"input": "3 1 1 1",
"output": "2"
},
{
"input": "1 2 2 2",
"output": "2"
}
] | 1,692,294,018 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 92 | 0 | def min_horseshoes_to_buy(s1, s2, s3, s4):
unique_colors = set([s1, s2, s3, s4])
return 4 - len(unique_colors)
s1, s2, s3, s4 = map(int, input().split())
min_to_buy = min_horseshoes_to_buy(s1, s2, s3, s4)
print(min_to_buy) | Title: Is your horseshoe on the other hoof?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
Input Specification:
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
Output Specification:
Print a single integer — the minimum number of horseshoes Valera needs to buy.
Demo Input:
['1 7 3 3\n', '7 7 7 7\n']
Demo Output:
['1\n', '3\n']
Note:
none | ```python
def min_horseshoes_to_buy(s1, s2, s3, s4):
unique_colors = set([s1, s2, s3, s4])
return 4 - len(unique_colors)
s1, s2, s3, s4 = map(int, input().split())
min_to_buy = min_horseshoes_to_buy(s1, s2, s3, s4)
print(min_to_buy)
``` | 3 |
|
799 | A | Carrot Cakes | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | null | null | In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable. | The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven. | If it is reasonable to build the second oven, print "YES". Otherwise print "NO". | [
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] | [
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] | In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | 500 | [
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,681,020,720 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 4 | 62 | 0 | n, t, k, d = map(int,input().split())
print("NO" if ((n/k<=2) and t== d) or k>=n else "YES") | Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | ```python
n, t, k, d = map(int,input().split())
print("NO" if ((n/k<=2) and t== d) or k>=n else "YES")
``` | 0 |
|
552 | B | Vanya and Books | PROGRAMMING | 1,200 | [
"implementation",
"math"
] | null | null | Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books. | The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library. | Print the number of digits needed to number all the books. | [
"13\n",
"4\n"
] | [
"17\n",
"4\n"
] | Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits. | 1,000 | [
{
"input": "13",
"output": "17"
},
{
"input": "4",
"output": "4"
},
{
"input": "100",
"output": "192"
},
{
"input": "99",
"output": "189"
},
{
"input": "1000000000",
"output": "8888888899"
},
{
"input": "1000000",
"output": "5888896"
},
{
"input": "999",
"output": "2889"
},
{
"input": "55",
"output": "101"
},
{
"input": "222222222",
"output": "1888888896"
},
{
"input": "8",
"output": "8"
},
{
"input": "13",
"output": "17"
},
{
"input": "313",
"output": "831"
},
{
"input": "1342",
"output": "4261"
},
{
"input": "30140",
"output": "139594"
},
{
"input": "290092",
"output": "1629447"
},
{
"input": "2156660",
"output": "13985516"
},
{
"input": "96482216",
"output": "760746625"
},
{
"input": "943006819",
"output": "8375950269"
},
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "7"
},
{
"input": "35",
"output": "61"
},
{
"input": "996",
"output": "2880"
},
{
"input": "6120",
"output": "23373"
},
{
"input": "30660",
"output": "142194"
},
{
"input": "349463",
"output": "1985673"
},
{
"input": "8171970",
"output": "56092686"
},
{
"input": "36123011",
"output": "277872985"
},
{
"input": "986747865",
"output": "8769619683"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "11"
},
{
"input": "11",
"output": "13"
},
{
"input": "101",
"output": "195"
},
{
"input": "1000",
"output": "2893"
},
{
"input": "1001",
"output": "2897"
},
{
"input": "9999",
"output": "38889"
},
{
"input": "10000",
"output": "38894"
},
{
"input": "10001",
"output": "38899"
},
{
"input": "99999",
"output": "488889"
},
{
"input": "100000",
"output": "488895"
},
{
"input": "100001",
"output": "488901"
},
{
"input": "999999",
"output": "5888889"
},
{
"input": "1000001",
"output": "5888903"
},
{
"input": "9999999",
"output": "68888889"
},
{
"input": "10000000",
"output": "68888897"
},
{
"input": "10000001",
"output": "68888905"
},
{
"input": "99999999",
"output": "788888889"
},
{
"input": "100000000",
"output": "788888898"
},
{
"input": "100000001",
"output": "788888907"
},
{
"input": "999999999",
"output": "8888888889"
},
{
"input": "95",
"output": "181"
},
{
"input": "995",
"output": "2877"
},
{
"input": "9995",
"output": "38873"
},
{
"input": "99995",
"output": "488869"
},
{
"input": "999999995",
"output": "8888888853"
},
{
"input": "999999998",
"output": "8888888880"
}
] | 1,441,060,021 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 4 | 1,000 | 0 | n = int(input())
print(sum(len(str(i)) for i in range(1, n + 1))) | Title: Vanya and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
Output Specification:
Print the number of digits needed to number all the books.
Demo Input:
['13\n', '4\n']
Demo Output:
['17\n', '4\n']
Note:
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits. | ```python
n = int(input())
print(sum(len(str(i)) for i in range(1, n + 1)))
``` | 0 |
|
427 | A | Police Recruits | PROGRAMMING | 800 | [
"implementation"
] | null | null | The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated. | The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time. | Print a single integer, the number of crimes which will go untreated. | [
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] | [
"2\n",
"1\n",
"8\n"
] | Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated. | 500 | [
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,681,675,917 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 92 | 2,150,400 | n = int(input())
l = list(map(int,input.split()))
count = 0
sum = 0
for i in len(l):
if sum<0:
count+=1
sum+=1
print(count) | Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated. | ```python
n = int(input())
l = list(map(int,input.split()))
count = 0
sum = 0
for i in len(l):
if sum<0:
count+=1
sum+=1
print(count)
``` | -1 |
|
205 | A | Little Elephant and Rozdil | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities. | Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes). | [
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] | [
"2\n",
"Still Rozdil\n"
] | In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil". | 500 | [
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,647,313,813 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 62 | 0 | cities = int(input())
time = list(map(lambda x: int(x), input().split(" ")))
min_t = min(time)
has_dup = time.count(min_t) > 1
if(has_dup):
print("Still Rodzill")
else:
print(time.index(min_t) + 1)
| Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil". | ```python
cities = int(input())
time = list(map(lambda x: int(x), input().split(" ")))
min_t = min(time)
has_dup = time.count(min_t) > 1
if(has_dup):
print("Still Rodzill")
else:
print(time.index(min_t) + 1)
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | You have *n* devices that you want to use simultaneously.
The *i*-th device uses *a**i* units of power per second. This usage is continuous. That is, in λ seconds, the device will use λ·*a**i* units of power. The *i*-th device currently has *b**i* units of power stored. All devices can store an arbitrary amount of power.
You have a single charger that can plug to any single device. The charger will add *p* units of power per second to a device. This charging is continuous. That is, if you plug in a device for λ seconds, it will gain λ·*p* units of power. You can switch which device is charging at any arbitrary unit of time (including real numbers), and the time it takes to switch is negligible.
You are wondering, what is the maximum amount of time you can use the devices until one of them hits 0 units of power.
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power. | The first line contains two integers, *n* and *p* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*p*<=≤<=109) — the number of devices and the power of the charger.
This is followed by *n* lines which contain two integers each. Line *i* contains the integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=100<=000) — the power of the device and the amount of power stored in the device in the beginning. | If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=4.
Namely, let's assume that your answer is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if . | [
"2 1\n2 2\n2 1000\n",
"1 100\n1 1\n",
"3 5\n4 3\n5 2\n6 1\n"
] | [
"2.0000000000",
"-1\n",
"0.5000000000"
] | In sample test 1, you can charge the first device for the entire time until it hits zero power. The second device has enough power to last this time without being charged.
In sample test 2, you can use the device indefinitely.
In sample test 3, we can charge the third device for 2 / 5 of a second, then switch to charge the second device for a 1 / 10 of a second. | 0 | [
{
"input": "2 1\n2 2\n2 1000",
"output": "2.0000000000"
},
{
"input": "1 100\n1 1",
"output": "-1"
},
{
"input": "3 5\n4 3\n5 2\n6 1",
"output": "0.5000000000"
},
{
"input": "1 1\n1 87",
"output": "-1"
},
{
"input": "1 1\n100 77",
"output": "0.7777777778"
},
{
"input": "5 10\n3 81\n3 49\n1 20\n1 12\n1 30",
"output": "-1"
},
{
"input": "5 10\n4 3\n1 54\n2 57\n2 31\n1 99",
"output": "-1"
},
{
"input": "5 10\n2 81\n3 31\n4 49\n1 35\n1 67",
"output": "263.0000000000"
},
{
"input": "10 1\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92\n1 92",
"output": "102.2222222222"
},
{
"input": "10 1\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16\n1 16",
"output": "17.7777777778"
},
{
"input": "10 1\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40\n1 40",
"output": "44.4444444444"
},
{
"input": "2 1\n1 10\n1 10",
"output": "20.0000000000"
},
{
"input": "20 16807\n75250 50074\n43659 8931\n11273 27545\n50879 77924\n37710 64441\n38166 84493\n43043 7988\n22504 82328\n31730 78841\n42613 44304\n33170 17710\n97158 29561\n70934 93100\n80279 51817\n95336 99098\n7827 13513\n29268 23811\n77634 80980\n79150 36580\n58822 11968",
"output": "0.2244225704"
}
] | 1,492,361,178 | 4,278 | Python 3 | WRONG_ANSWER | PRETESTS | 1 | 46 | 4,608,000 | # eps = 10**-6
#def s():
#n, power = (int(x) for x in input().split())
n__power = input().split()
n = int(n__power[0])
power = int(n__power[1])
items = []
for _ in range(n):
p__a = input().split()
p = int(p__a[0])
a = int(p__a[1])
time = a/p
items.append( (time, p, a))
items.sort()
sys_power = -power
sys_amount = 0
sys_time = None
while len(items) > 0:
t, p, a = items.pop(0)
if sys_time is not None and sys_time < t:
break
sys_power += p
sys_amount += a
if sys_power > 0:
sys_time = sys_amount / sys_power
if sys_time is None: print( '-1')
print( sys_time)
#print(s()) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have *n* devices that you want to use simultaneously.
The *i*-th device uses *a**i* units of power per second. This usage is continuous. That is, in λ seconds, the device will use λ·*a**i* units of power. The *i*-th device currently has *b**i* units of power stored. All devices can store an arbitrary amount of power.
You have a single charger that can plug to any single device. The charger will add *p* units of power per second to a device. This charging is continuous. That is, if you plug in a device for λ seconds, it will gain λ·*p* units of power. You can switch which device is charging at any arbitrary unit of time (including real numbers), and the time it takes to switch is negligible.
You are wondering, what is the maximum amount of time you can use the devices until one of them hits 0 units of power.
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Input Specification:
The first line contains two integers, *n* and *p* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*p*<=≤<=109) — the number of devices and the power of the charger.
This is followed by *n* lines which contain two integers each. Line *i* contains the integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=100<=000) — the power of the device and the amount of power stored in the device in the beginning.
Output Specification:
If you can use the devices indefinitely, print -1. Otherwise, print the maximum amount of time before any one device hits 0 power.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=4.
Namely, let's assume that your answer is *a* and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['2 1\n2 2\n2 1000\n', '1 100\n1 1\n', '3 5\n4 3\n5 2\n6 1\n']
Demo Output:
['2.0000000000', '-1\n', '0.5000000000']
Note:
In sample test 1, you can charge the first device for the entire time until it hits zero power. The second device has enough power to last this time without being charged.
In sample test 2, you can use the device indefinitely.
In sample test 3, we can charge the third device for 2 / 5 of a second, then switch to charge the second device for a 1 / 10 of a second. | ```python
# eps = 10**-6
#def s():
#n, power = (int(x) for x in input().split())
n__power = input().split()
n = int(n__power[0])
power = int(n__power[1])
items = []
for _ in range(n):
p__a = input().split()
p = int(p__a[0])
a = int(p__a[1])
time = a/p
items.append( (time, p, a))
items.sort()
sys_power = -power
sys_amount = 0
sys_time = None
while len(items) > 0:
t, p, a = items.pop(0)
if sys_time is not None and sys_time < t:
break
sys_power += p
sys_amount += a
if sys_power > 0:
sys_time = sys_amount / sys_power
if sys_time is None: print( '-1')
print( sys_time)
#print(s())
``` | 0 |
|
784 | F | Crunching Numbers Just for You | PROGRAMMING | 1,900 | [
"*special",
"implementation"
] | null | null | You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done...
You are given an array of integers. Sort it in non-descending order. | The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100). | Output space-separated elements of the sorted array. | [
"3 3 1 2\n"
] | [
"1 2 3 \n"
] | Remember, this is a very important feature, and you have to make sure the customers appreciate it! | 0 | [
{
"input": "3 3 1 2",
"output": "1 2 3 "
},
{
"input": "10 54 100 27 1 33 27 80 49 27 6",
"output": "1 6 27 27 27 33 49 54 80 100 "
}
] | 1,689,367,899 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | print("_RANDOM_GUESS_1689367899.390684")# 1689367899.390698 | Title: Crunching Numbers Just for You
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are developing a new feature for the website which sells airline tickets: being able to sort tickets by price! You have already extracted the tickets' prices, so there's just the last step to be done...
You are given an array of integers. Sort it in non-descending order.
Input Specification:
The input consists of a single line of space-separated integers. The first number is *n* (1<=≤<=*n*<=≤<=10) — the size of the array. The following *n* numbers are the elements of the array (1<=≤<=*a**i*<=≤<=100).
Output Specification:
Output space-separated elements of the sorted array.
Demo Input:
['3 3 1 2\n']
Demo Output:
['1 2 3 \n']
Note:
Remember, this is a very important feature, and you have to make sure the customers appreciate it! | ```python
print("_RANDOM_GUESS_1689367899.390684")# 1689367899.390698
``` | 0 |
|
507 | A | Amr and Music | PROGRAMMING | 1,000 | [
"greedy",
"implementation",
"sortings"
] | null | null | Amr is a young coder who likes music a lot. He always wanted to learn how to play music but he was busy coding so he got an idea.
Amr has *n* instruments, it takes *a**i* days to learn *i*-th instrument. Being busy, Amr dedicated *k* days to learn how to play the maximum possible number of instruments.
Amr asked for your help to distribute his free days between instruments so that he can achieve his goal. | The first line contains two numbers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=10<=000), the number of instruments and number of days respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100), representing number of days required to learn the *i*-th instrument. | In the first line output one integer *m* representing the maximum number of instruments Amr can learn.
In the second line output *m* space-separated integers: the indices of instruments to be learnt. You may output indices in any order.
if there are multiple optimal solutions output any. It is not necessary to use all days for studying. | [
"4 10\n4 3 1 2\n",
"5 6\n4 3 1 1 2\n",
"1 3\n4\n"
] | [
"4\n1 2 3 4",
"3\n1 3 4",
"0\n"
] | In the first test Amr can learn all 4 instruments.
In the second test other possible solutions are: {2, 3, 5} or {3, 4, 5}.
In the third test Amr doesn't have enough time to learn the only presented instrument. | 500 | [
{
"input": "4 10\n4 3 1 2",
"output": "4\n1 2 3 4"
},
{
"input": "5 6\n4 3 1 1 2",
"output": "3\n3 4 5"
},
{
"input": "1 3\n4",
"output": "0"
},
{
"input": "2 100\n100 100",
"output": "1\n1"
},
{
"input": "3 150\n50 50 50",
"output": "3\n1 2 3"
},
{
"input": "4 0\n100 100 100 100",
"output": "0"
},
{
"input": "100 7567\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "75\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75"
},
{
"input": "68 3250\n95 84 67 7 82 75 100 39 31 45 69 100 8 97 13 58 74 40 88 69 35 91 94 28 62 85 51 97 37 15 87 51 24 96 89 49 53 54 35 17 23 54 51 91 94 18 26 92 79 63 23 37 98 43 16 44 82 25 100 59 97 3 60 92 76 58 56 50",
"output": "60\n1 2 3 4 5 6 8 9 10 11 13 15 16 17 18 19 20 21 22 23 24 25 26 27 29 30 31 32 33 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 54 55 56 57 58 60 62 63 64 65 66 67 68"
},
{
"input": "100 10000\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100"
},
{
"input": "25 1293\n96 13 7 2 81 72 39 45 5 88 47 23 60 81 54 46 63 52 41 57 2 87 90 28 93",
"output": "25\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25"
},
{
"input": "98 7454\n71 57 94 76 52 90 76 81 67 60 99 88 98 61 73 61 80 91 88 93 53 55 88 64 71 55 81 76 52 63 87 99 84 66 65 52 83 99 92 62 95 81 90 67 64 57 80 80 67 75 77 58 71 85 97 50 97 55 52 59 55 96 57 53 85 100 95 95 74 51 78 88 66 98 97 86 94 81 56 64 61 57 67 95 85 82 85 60 76 95 69 95 76 91 74 100 69 76",
"output": "98\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98"
},
{
"input": "5 249\n96 13 7 2 81",
"output": "5\n1 2 3 4 5"
},
{
"input": "61 3331\n12 63 99 56 57 70 53 21 41 82 97 63 42 91 18 84 99 78 85 89 6 63 76 28 33 78 100 46 78 78 32 13 11 12 73 50 34 60 12 73 9 19 88 100 28 51 50 45 51 10 78 38 25 22 8 40 71 55 56 83 44",
"output": "61\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61"
},
{
"input": "99 10000\n42 88 21 63 59 38 23 100 86 37 57 86 11 22 19 89 6 19 15 64 18 77 83 29 14 26 80 73 8 51 14 19 9 98 81 96 47 77 22 19 86 71 91 61 84 8 80 28 6 25 33 95 96 21 57 92 96 57 31 88 38 32 70 19 25 67 29 78 18 90 37 50 62 33 49 16 47 39 9 33 88 69 69 29 14 66 75 76 41 98 40 52 65 25 33 47 39 24 80",
"output": "99\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99"
},
{
"input": "89 4910\n44 9 31 70 85 72 55 9 85 84 63 43 92 85 10 34 83 28 73 45 62 7 34 52 89 58 24 10 28 6 72 45 57 36 71 34 26 24 38 59 5 15 48 82 58 99 8 77 49 84 14 58 29 46 88 50 13 7 58 23 40 63 96 23 46 31 17 8 59 93 12 76 69 20 43 44 91 78 68 94 37 27 100 65 40 25 52 30 97",
"output": "89\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89"
},
{
"input": "40 2110\n91 18 52 22 26 67 59 10 55 43 97 78 20 81 99 36 33 12 86 32 82 87 70 63 48 48 45 94 78 23 77 15 68 17 71 54 44 98 54 8",
"output": "39\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40"
},
{
"input": "27 1480\n38 95 9 36 21 70 19 89 35 46 7 31 88 25 10 72 81 32 65 83 68 57 50 20 73 42 12",
"output": "27\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27"
},
{
"input": "57 2937\n84 73 23 62 93 64 23 17 53 100 47 67 52 53 90 58 19 84 33 69 46 47 50 28 73 74 40 42 92 70 32 29 57 52 23 82 42 32 46 83 45 87 40 58 50 51 48 37 57 52 78 26 21 54 16 66 93",
"output": "55\n1 2 3 4 5 6 7 8 9 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56"
},
{
"input": "6 41\n6 8 9 8 9 8",
"output": "5\n1 2 3 4 6"
},
{
"input": "9 95\n9 11 12 11 12 11 8 11 10",
"output": "9\n1 2 3 4 5 6 7 8 9"
},
{
"input": "89 6512\n80 87 61 91 85 51 58 69 79 57 81 67 74 55 88 70 77 61 55 81 56 76 79 67 92 52 54 73 67 72 81 54 72 81 65 88 83 57 83 92 62 66 63 58 61 66 92 77 73 66 71 85 92 73 82 65 76 64 58 62 64 51 90 59 79 70 86 89 86 51 72 61 60 71 52 74 58 72 77 91 91 60 76 56 64 55 61 81 52",
"output": "89\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89"
},
{
"input": "5 29\n6 3 7 2 1",
"output": "5\n1 2 3 4 5"
},
{
"input": "5 49\n16 13 7 2 1",
"output": "5\n1 2 3 4 5"
},
{
"input": "6 84\n16 21 25 6 17 16",
"output": "5\n1 2 4 5 6"
},
{
"input": "4 9\n7 4 2 1",
"output": "3\n2 3 4"
},
{
"input": "50 2500\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50",
"output": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50"
},
{
"input": "100 10000\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100"
},
{
"input": "96 514\n6 3 7 2 1 2 9 5 5 8 7 3 10 1 4 6 3 2 1 7 2 7 10 8 3 8 10 4 8 8 2 5 3 2 1 4 4 8 4 3 3 7 4 4 2 7 8 3 9 2 2 6 3 4 8 6 7 5 4 3 10 7 6 5 10 1 7 10 7 7 8 2 1 2 3 10 9 8 8 2 7 1 2 7 10 1 2 2 3 8 6 2 9 6 9 6",
"output": "96\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96"
},
{
"input": "47 350\n6 1 9 12 8 8 11 4 4 8 8 3 3 2 12 7 7 7 12 2 9 1 5 10 6 1 5 2 6 3 9 13 8 3 10 10 10 10 6 9 10 10 8 5 12 11 3",
"output": "47\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47"
},
{
"input": "100 200\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100"
},
{
"input": "2 10000\n1 1",
"output": "2\n1 2"
},
{
"input": "1 2\n1",
"output": "1\n1"
},
{
"input": "1 3\n2",
"output": "1\n1"
},
{
"input": "34 4964\n37 27 90 83 36 59 80 7 28 41 97 72 64 8 40 30 76 4 92 51 52 44 42 13 38 64 60 66 47 93 30 35 71 71",
"output": "34\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34"
},
{
"input": "2 2\n1 10",
"output": "1\n1"
},
{
"input": "2 5\n1 1",
"output": "2\n1 2"
},
{
"input": "1 4\n3",
"output": "1\n1"
},
{
"input": "4 384\n1 2 3 4",
"output": "4\n1 2 3 4"
}
] | 1,643,854,904 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | n,k = map(int, input().split())
a = [int(i) for i in input().split()]
b = sorted(a)
c = []
for i in range(n):
if k <= 0:
break
if b[i] <= k:
ind = a.index(b[i]) + 1
while ind in c:
ind = a.index(b[i], ind-1, n)
c.append(ind)
k -= a[i]
print(len(c))
print(*c, sep=" ") | Title: Amr and Music
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr is a young coder who likes music a lot. He always wanted to learn how to play music but he was busy coding so he got an idea.
Amr has *n* instruments, it takes *a**i* days to learn *i*-th instrument. Being busy, Amr dedicated *k* days to learn how to play the maximum possible number of instruments.
Amr asked for your help to distribute his free days between instruments so that he can achieve his goal.
Input Specification:
The first line contains two numbers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=10<=000), the number of instruments and number of days respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100), representing number of days required to learn the *i*-th instrument.
Output Specification:
In the first line output one integer *m* representing the maximum number of instruments Amr can learn.
In the second line output *m* space-separated integers: the indices of instruments to be learnt. You may output indices in any order.
if there are multiple optimal solutions output any. It is not necessary to use all days for studying.
Demo Input:
['4 10\n4 3 1 2\n', '5 6\n4 3 1 1 2\n', '1 3\n4\n']
Demo Output:
['4\n1 2 3 4', '3\n1 3 4', '0\n']
Note:
In the first test Amr can learn all 4 instruments.
In the second test other possible solutions are: {2, 3, 5} or {3, 4, 5}.
In the third test Amr doesn't have enough time to learn the only presented instrument. | ```python
n,k = map(int, input().split())
a = [int(i) for i in input().split()]
b = sorted(a)
c = []
for i in range(n):
if k <= 0:
break
if b[i] <= k:
ind = a.index(b[i]) + 1
while ind in c:
ind = a.index(b[i], ind-1, n)
c.append(ind)
k -= a[i]
print(len(c))
print(*c, sep=" ")
``` | 0 |
|
32 | B | Borze | PROGRAMMING | 800 | [
"expression parsing",
"implementation"
] | B. Borze | 2 | 256 | Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet. | The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes). | Output the decoded ternary number. It can have leading zeroes. | [
".-.--\n",
"--.\n",
"-..-.--\n"
] | [
"012",
"20",
"1012"
] | none | 1,000 | [
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,660,912,520 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | s=input()
n=len(s)
l=[]
i=0
while i <n:
if s[i]=='-' and s[i+1]=='.':
l.append(1)
i=i+2
elif s[i]=='-' and s[i+1]=='-':
l.append(2)
i=i+2
else:
l.append(0)
i=i+1
print(*l,' ')
| Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none | ```python
s=input()
n=len(s)
l=[]
i=0
while i <n:
if s[i]=='-' and s[i+1]=='.':
l.append(1)
i=i+2
elif s[i]=='-' and s[i+1]=='-':
l.append(2)
i=i+2
else:
l.append(0)
i=i+1
print(*l,' ')
``` | 0 |
899 | A | Splitting in Teams | PROGRAMMING | 800 | [
"constructive algorithms",
"greedy",
"math"
] | null | null | There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team. | The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*. | Print the maximum number of teams of three people the coach can form. | [
"4\n1 1 2 1\n",
"2\n2 2\n",
"7\n2 2 2 1 1 1 1\n",
"3\n1 1 1\n"
] | [
"1\n",
"0\n",
"3\n",
"1\n"
] | In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person). | 500 | [
{
"input": "4\n1 1 2 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "0"
},
{
"input": "7\n2 2 2 1 1 1 1",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n2 2 1 1 1",
"output": "2"
},
{
"input": "7\n1 1 2 2 1 2 1",
"output": "3"
},
{
"input": "10\n1 2 2 1 2 2 1 2 1 1",
"output": "5"
},
{
"input": "5\n2 2 2 1 2",
"output": "1"
},
{
"input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2",
"output": "10"
},
{
"input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2",
"output": "34"
},
{
"input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2",
"output": "32"
},
{
"input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2",
"output": "9"
},
{
"input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1",
"output": "11"
},
{
"input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2",
"output": "100"
},
{
"input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2",
"output": "123"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "3\n2 2 1",
"output": "1"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "4\n1 1 2 2",
"output": "2"
},
{
"input": "4\n1 2 2 2",
"output": "1"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n1 1 1 1 2",
"output": "2"
},
{
"input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1"
},
{
"input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2",
"output": "1"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "3"
},
{
"input": "5\n2 1 1 1 1",
"output": "2"
},
{
"input": "9\n1 1 1 1 1 1 2 2 2",
"output": "4"
},
{
"input": "10\n2 2 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "2"
}
] | 1,513,664,119 | 2,147,483,647 | Python 3 | OK | TESTS | 67 | 140 | 9,420,800 | n = int(input())
one=0
two=0
l = [int(x) for x in input().split()]
ans = 0
for x in l:
if x == 1:
one += 1
else:
two += 1
ans += min(one,two)
one -= ans
p = int(one/3)
ans += p
print(ans)
| Title: Splitting in Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Output Specification:
Print the maximum number of teams of three people the coach can form.
Demo Input:
['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n']
Demo Output:
['1\n', '0\n', '3\n', '1\n']
Note:
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person). | ```python
n = int(input())
one=0
two=0
l = [int(x) for x in input().split()]
ans = 0
for x in l:
if x == 1:
one += 1
else:
two += 1
ans += min(one,two)
one -= ans
p = int(one/3)
ans += p
print(ans)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | You already know that Valery's favorite sport is biathlon. Due to your help, he learned to shoot without missing, and his skills are unmatched at the shooting range. But now a smaller task is to be performed, he should learn to complete the path fastest.
The track's map is represented by a rectangle *n*<=×<=*m* in size divided into squares. Each square is marked with a lowercase Latin letter (which means the type of the plot), with the exception of the starting square (it is marked with a capital Latin letters *S*) and the terminating square (it is marked with a capital Latin letter *T*). The time of movement from one square to another is equal to 1 minute. The time of movement within the cell can be neglected. We can move from the cell only to side-adjacent ones, but it is forbidden to go beyond the map edges. Also the following restriction is imposed on the path: it is not allowed to visit more than *k* different types of squares (squares of one type can be visited an infinite number of times). Squares marked with *S* and *T* have no type, so they are not counted. But *S* must be visited exactly once — at the very beginning, and *T* must be visited exactly once — at the very end.
Your task is to find the path from the square *S* to the square *T* that takes minimum time. Among all shortest paths you should choose the lexicographically minimal one. When comparing paths you should lexicographically represent them as a sequence of characters, that is, of plot types. | The first input line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=50,<=*n*·*m*<=≥<=2,<=1<=≤<=*k*<=≤<=4). Then *n* lines contain the map. Each line has the length of exactly *m* characters and consists of lowercase Latin letters and characters *S* and *T*. It is guaranteed that the map contains exactly one character *S* and exactly one character *T*.
Pretest 12 is one of the maximal tests for this problem. | If there is a path that satisfies the condition, print it as a sequence of letters — the plot types. Otherwise, print "-1" (without quotes). You shouldn't print the character *S* in the beginning and *T* in the end.
Note that this sequence may be empty. This case is present in pretests. You can just print nothing or print one "End of line"-character. Both will be accepted. | [
"5 3 2\nSba\nccc\naac\nccc\nabT\n",
"3 4 1\nSxyy\nyxxx\nyyyT\n",
"1 3 3\nTyS\n",
"1 4 1\nSxyT\n"
] | [
"bcccc\n",
"xxxx\n",
"y\n",
"-1\n"
] | none | 0 | [
{
"input": "5 3 2\nSba\nccc\naac\nccc\nabT",
"output": "bcccc"
},
{
"input": "3 4 1\nSxyy\nyxxx\nyyyT",
"output": "xxxx"
},
{
"input": "1 3 3\nTyS",
"output": "y"
},
{
"input": "1 4 1\nSxyT",
"output": "-1"
},
{
"input": "1 3 3\nSaT",
"output": "a"
},
{
"input": "3 4 1\nSbbT\naaaa\nabba",
"output": "bb"
},
{
"input": "3 5 2\nSbcaT\nacbab\nacccb",
"output": "aacccaa"
},
{
"input": "3 4 1\nSbbb\naaaT\nabbc",
"output": "aaa"
},
{
"input": "3 4 2\nSbbb\naabT\nabbc",
"output": "aab"
},
{
"input": "4 5 3\nabaaa\nbabaT\nSabba\naaaaa",
"output": "aaba"
},
{
"input": "6 6 3\npkhipk\nmlfmak\naqmbae\ndlbfSj\ndpbjcr\naTbqbm",
"output": "cbqb"
},
{
"input": "1 20 3\nacbccbbddbffScTadffd",
"output": "c"
},
{
"input": "1 30 2\nbmjcfldkloleiqqiTnmdjpaSckkijf",
"output": "-1"
},
{
"input": "1 40 1\nfaSfgfTcfadcdfagfbccbffbeaaebagbfcfcgdfd",
"output": "-1"
},
{
"input": "1 50 3\nSaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaTaaaaaaaaaaa",
"output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "5 10 4\naaaaaaaaaa\naaaaaTaaaa\naaaaaaaSaa\naaaaaaaaaa\naaaaaaaaaa",
"output": "aa"
},
{
"input": "5 3 4\naaT\nacc\nbbb\nbbc\ncSb",
"output": "bbbc"
},
{
"input": "5 5 1\ncaTbc\ndccac\ndacda\naacaS\ncdcab",
"output": "-1"
},
{
"input": "10 8 2\nbdcdcbfa\ndecffcce\ndTffdacb\neeedcdbb\nfdbbbcba\nddabfcda\nabdbSeed\nbdcdcffa\ncadbaffa\nfcccddad",
"output": "bbbbee"
},
{
"input": "20 10 3\nebebccacdb\neeebccddeT\neadebecaac\nadeeeaccbc\nbaccccdaed\ndeabceabba\ndadbecbaaa\neacbbcedcb\naeeScdbbab\nbabaecaead\nbacdbebeae\naacbadbeec\nacddceecca\nacaeaebaba\ncdddeaaeae\neabddadade\nddddaeaeed\nbccbaacadd\ndccccbabdc\necdaebeccc",
"output": "bbbcccaccaac"
},
{
"input": "15 10 4\nsejwprqjku\npnjsiopxft\nrsplgvwixq\nendglkchxl\nftihbbexgh\nsxtxbbavge\njcdkusfnmr\nskgsqvflia\nkcxmcxjpae\namaiwcfile\nnjgjSunmwd\nldxvahgreu\necmrajbjuT\nnaioqigols\npbwrmxkltj",
"output": "aajbju"
},
{
"input": "15 3 4\nllv\nttT\nhbo\nogc\nkfe\ngli\nfbx\nkfp\nspm\ncxc\nndw\nSoa\npfh\nedr\nxmv",
"output": "-1"
},
{
"input": "15 15 3\ncbbdccabdcbacbd\nbcabdcacadacdbc\ncbcddbbcdbddcad\nddcabdbbdcabbdc\naabadcccTcabdbb\ncbacaaacaabdbbd\ndbdcbSdabaadbdb\ndbbaddcdddaadbb\nbbddcdcbaccbbaa\nadadadbdbbddccc\ncddbbdaddcbbdcc\nbbaadcdbbcaacca\nadbdcdbbcbddbcd\ncdadbcccddcdbda\ncbcdaabdcabccbc",
"output": "aaca"
},
{
"input": "20 20 2\nddadfcdeTaeccbedeaec\nacafdfdeaffdeabdcefe\nabbcbefcdbbbcdebafef\nfdafdcccbcdeeaedeffc\ndfdaabdefdafabaabcef\nfebdcabacaaaabfacbbe\nabfcaacadfdbfdbaaefd\ndacceeccddccaccdbbce\ncacebecabedbddfbfdad\ndacbfcabbebfddcedffd\ncfcdfacfadcfbcebebaa\nddfbebafaccbebeefbac\nebfaebacbbebdfcbcbea\ndfbaebcfccacfeaccaad\nedeedeceebcbfdbcdbbe\nafaacccfbdecebfdabed\nddbdcedacedadeccaeec\necbSeacbdcccbcedafef\ncfdbeeffbeeafccfdddb\ncefdbdfbabccfdaaadbf",
"output": "-1"
},
{
"input": "10 10 2\nbaaaaaaaaa\nbffacffffa\nbggaccggga\nbbbSccchha\nbdddddccia\nbjddccccca\nbkkdddTaaa\nblllddblla\nbmmmmdbmma\nbbbbbbbbbb",
"output": "ccccc"
},
{
"input": "10 20 3\nbaaaaaaaaaaaaaaaaaaa\nbfffffffacfffffffffa\nbgggggggaccgggggggga\nbbbbbbbbSccchhhhhhha\nbiiiiidddddcciiiiiia\nbjjjjjjddcccccjjjjja\nbkkkkkkkdddTaaaaaaaa\nbllllllllddbllllllla\nbmmmmmmmmmdbmmmmmmma\nbbbbbbbbbbbbbbbbbbbb",
"output": "ccccc"
},
{
"input": "20 10 4\nbaaaaaaaaa\nbffacffffa\nbggaccggga\nbhhaccchha\nbiiaccccia\nbjjaccccca\nbkkakkkkka\nbllallllla\nbbbSmmmmma\nbnnnnnnnna\nbooooooooa\nbpppppTaaa\nbqqqqqbqqa\nbrrrrrbrra\nbdddddbssa\nbtddddbtta\nbuudddbuua\nbvvvddbvva\nbwwwwdbwwa\nbbbbbbbbbb",
"output": "mmmno"
},
{
"input": "20 20 2\nbaaaaaaaaaaaaaaaaaaa\nbfffffffacfffffffffa\nbgggggggaccgggggggga\nbhhhhhhhaccchhhhhhha\nbiiiiiiiacccciiiiiia\nbjjjjjjjacccccjjjjja\nbkkkkkkkacccccckkkka\nblllllllacccccccllla\nbbbbbbbbSccccccccmma\nbddddddddddcccccccna\nbodddddddcccccccccca\nbppddddddddTaaaaaaaa\nbqqqdddddddbqqqqqqqa\nbrrrrddddddbrrrrrrra\nbsssssdddddbsssssssa\nbttttttddddbttttttta\nbuuuuuuudddbuuuuuuua\nbvvvvvvvvddbvvvvvvva\nbwwwwwwwwwdbwwwwwwwa\nbbbbbbbbbbbbbbbbbbbb",
"output": "ccccc"
},
{
"input": "1 10 2\nbaaSaaTacb",
"output": "aa"
}
] | 1,689,422,435 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | print("_RANDOM_GUESS_1689422435.612158")# 1689422435.612176 | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You already know that Valery's favorite sport is biathlon. Due to your help, he learned to shoot without missing, and his skills are unmatched at the shooting range. But now a smaller task is to be performed, he should learn to complete the path fastest.
The track's map is represented by a rectangle *n*<=×<=*m* in size divided into squares. Each square is marked with a lowercase Latin letter (which means the type of the plot), with the exception of the starting square (it is marked with a capital Latin letters *S*) and the terminating square (it is marked with a capital Latin letter *T*). The time of movement from one square to another is equal to 1 minute. The time of movement within the cell can be neglected. We can move from the cell only to side-adjacent ones, but it is forbidden to go beyond the map edges. Also the following restriction is imposed on the path: it is not allowed to visit more than *k* different types of squares (squares of one type can be visited an infinite number of times). Squares marked with *S* and *T* have no type, so they are not counted. But *S* must be visited exactly once — at the very beginning, and *T* must be visited exactly once — at the very end.
Your task is to find the path from the square *S* to the square *T* that takes minimum time. Among all shortest paths you should choose the lexicographically minimal one. When comparing paths you should lexicographically represent them as a sequence of characters, that is, of plot types.
Input Specification:
The first input line contains three integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=50,<=*n*·*m*<=≥<=2,<=1<=≤<=*k*<=≤<=4). Then *n* lines contain the map. Each line has the length of exactly *m* characters and consists of lowercase Latin letters and characters *S* and *T*. It is guaranteed that the map contains exactly one character *S* and exactly one character *T*.
Pretest 12 is one of the maximal tests for this problem.
Output Specification:
If there is a path that satisfies the condition, print it as a sequence of letters — the plot types. Otherwise, print "-1" (without quotes). You shouldn't print the character *S* in the beginning and *T* in the end.
Note that this sequence may be empty. This case is present in pretests. You can just print nothing or print one "End of line"-character. Both will be accepted.
Demo Input:
['5 3 2\nSba\nccc\naac\nccc\nabT\n', '3 4 1\nSxyy\nyxxx\nyyyT\n', '1 3 3\nTyS\n', '1 4 1\nSxyT\n']
Demo Output:
['bcccc\n', 'xxxx\n', 'y\n', '-1\n']
Note:
none | ```python
print("_RANDOM_GUESS_1689422435.612158")# 1689422435.612176
``` | 0 |
|
453 | A | Little Pony and Expected Maximum | PROGRAMMING | 1,600 | [
"probabilities"
] | null | null | Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times. | A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105). | Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4. | [
"6 1\n",
"6 3\n",
"2 2\n"
] | [
"3.500000000000\n",
"4.958333333333\n",
"1.750000000000\n"
] | Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value | 500 | [
{
"input": "6 1",
"output": "3.500000000000"
},
{
"input": "6 3",
"output": "4.958333333333"
},
{
"input": "2 2",
"output": "1.750000000000"
},
{
"input": "5 4",
"output": "4.433600000000"
},
{
"input": "5 8",
"output": "4.814773760000"
},
{
"input": "3 10",
"output": "2.982641534996"
},
{
"input": "3 6",
"output": "2.910836762689"
},
{
"input": "1 8",
"output": "1.000000000000"
},
{
"input": "24438 9",
"output": "21994.699969310015"
},
{
"input": "94444 9",
"output": "85000.099992058866"
},
{
"input": "8 66716",
"output": "8.000000000000"
},
{
"input": "4 25132",
"output": "4.000000000000"
},
{
"input": "51520 73331",
"output": "51519.682650242677"
},
{
"input": "54230 31747",
"output": "54228.743352775018"
},
{
"input": "24236 90163",
"output": "24235.975171545670"
},
{
"input": "26946 99523",
"output": "26945.974480086279"
},
{
"input": "50323 7",
"output": "44033.124988408454"
},
{
"input": "53033 3",
"output": "39775.249995286234"
},
{
"input": "55743 5",
"output": "46452.999992525307"
},
{
"input": "59964 79",
"output": "59214.949890211828"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "3 1",
"output": "2.000000000000"
},
{
"input": "1 2",
"output": "1.000000000000"
},
{
"input": "53513 34040",
"output": "53511.875329020870"
},
{
"input": "100000 100000",
"output": "99999.418033254507"
},
{
"input": "1 100000",
"output": "1.000000000000"
},
{
"input": "100000 1",
"output": "50000.499999999935"
},
{
"input": "2 100000",
"output": "2.000000000000"
},
{
"input": "100000 2",
"output": "66667.166665000332"
},
{
"input": "50000 100000",
"output": "49999.843487110789"
},
{
"input": "99999 1111",
"output": "99909.571915885972"
},
{
"input": "99999 99999",
"output": "99998.418033254609"
},
{
"input": "1000 1000",
"output": "999.419018443269"
},
{
"input": "50000 50000",
"output": "49999.418043215679"
},
{
"input": "88888 88888",
"output": "88887.418034499773"
},
{
"input": "99999 100000",
"output": "99998.418042461126"
},
{
"input": "100000 555",
"output": "99820.643422392372"
},
{
"input": "10000 10000",
"output": "9999.418122897887"
},
{
"input": "100000 5001",
"output": "99980.503829474910"
},
{
"input": "100000 1000",
"output": "99900.599066768002"
}
] | 1,542,476,335 | 2,147,483,647 | PyPy 3 | OK | TESTS | 41 | 140 | 0 | n, m = map(int, input().split(' '))
ans = n
for i in range(1, n):
num = (n-i)/n
res = pow(num, m)
ans -= res
print(ans)
| Title: Little Pony and Expected Maximum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
Input Specification:
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output Specification:
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
Demo Input:
['6 1\n', '6 3\n', '2 2\n']
Demo Output:
['3.500000000000\n', '4.958333333333\n', '1.750000000000\n']
Note:
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value | ```python
n, m = map(int, input().split(' '))
ans = n
for i in range(1, n):
num = (n-i)/n
res = pow(num, m)
ans -= res
print(ans)
``` | 3 |
|
34 | B | Sale | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | B. Sale | 2 | 256 | Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets. | Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets. | [
"5 3\n-6 0 35 -2 4\n",
"4 2\n7 0 0 -7\n"
] | [
"8\n",
"7\n"
] | none | 1,000 | [
{
"input": "5 3\n-6 0 35 -2 4",
"output": "8"
},
{
"input": "4 2\n7 0 0 -7",
"output": "7"
},
{
"input": "6 6\n756 -611 251 -66 572 -818",
"output": "1495"
},
{
"input": "5 5\n976 437 937 788 518",
"output": "0"
},
{
"input": "5 3\n-2 -2 -2 -2 -2",
"output": "6"
},
{
"input": "5 1\n998 997 985 937 998",
"output": "0"
},
{
"input": "2 2\n-742 -187",
"output": "929"
},
{
"input": "3 3\n522 597 384",
"output": "0"
},
{
"input": "4 2\n-215 -620 192 647",
"output": "835"
},
{
"input": "10 6\n557 605 685 231 910 633 130 838 -564 -85",
"output": "649"
},
{
"input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59",
"output": "10"
},
{
"input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000",
"output": "0"
},
{
"input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886",
"output": "19441"
},
{
"input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999",
"output": "0"
},
{
"input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993",
"output": "16984"
},
{
"input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981",
"output": "21743"
},
{
"input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654",
"output": "81283"
},
{
"input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782",
"output": "0"
},
{
"input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823",
"output": "0"
},
{
"input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992",
"output": "75068"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 1\n555",
"output": "0"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n-24",
"output": "24"
}
] | 1,579,265,949 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 216 | 0 | N = [int(_) for _ in input().split()][1]
L = sorted([int(_) for _ in input().split()])
NewL = []
for i in range(N):
if L[i]<0:
NewL.append(abs(L[i]))
else:
NewL.append(-L[i])
print(sum(NewL)) | Title: Sale
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output Specification:
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
Demo Input:
['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n']
Demo Output:
['8\n', '7\n']
Note:
none | ```python
N = [int(_) for _ in input().split()][1]
L = sorted([int(_) for _ in input().split()])
NewL = []
for i in range(N):
if L[i]<0:
NewL.append(abs(L[i]))
else:
NewL.append(-L[i])
print(sum(NewL))
``` | 0 |
255 | A | Greg's Workout | PROGRAMMING | 800 | [
"implementation"
] | null | null | Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training. | The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises. | Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous. | [
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] | [
"biceps\n",
"back\n",
"chest\n"
] | In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | 500 | [
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,599,734,767 | 2,147,483,647 | PyPy 3 | OK | TESTS | 61 | 280 | 0 | import sys
input = sys.stdin.readline
############ ---- Input Functions ---- ############
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))#might need to remove the -1
def invr():
return(map(int,input().split()))
n = inp()
s = inlt()
i = 1
chest, biceps, back = 0, 0, 0
for j in range(n):
if i == 1:
chest += s[j]
i += 1
elif i == 2:
biceps += s[j]
i += 1
else:
back += s[j]
i = 1
w = max(chest, biceps, back)
if w == chest:
print('chest')
elif w == biceps:
print('biceps')
else:
print('back') | Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | ```python
import sys
input = sys.stdin.readline
############ ---- Input Functions ---- ############
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))#might need to remove the -1
def invr():
return(map(int,input().split()))
n = inp()
s = inlt()
i = 1
chest, biceps, back = 0, 0, 0
for j in range(n):
if i == 1:
chest += s[j]
i += 1
elif i == 2:
biceps += s[j]
i += 1
else:
back += s[j]
i = 1
w = max(chest, biceps, back)
if w == chest:
print('chest')
elif w == biceps:
print('biceps')
else:
print('back')
``` | 3 |
|
617 | B | Chocolate | PROGRAMMING | 1,300 | [
"combinatorics"
] | null | null | Bob loves everything sweet. His favorite chocolate bar consists of pieces, each piece may contain a nut. Bob wants to break the bar of chocolate into multiple pieces so that each part would contain exactly one nut and any break line goes between two adjacent pieces.
You are asked to calculate the number of ways he can do it. Two ways to break chocolate are considered distinct if one of them contains a break between some two adjacent pieces and the other one doesn't.
Please note, that if Bob doesn't make any breaks, all the bar will form one piece and it still has to have exactly one nut. | The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of pieces in the chocolate bar.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1), where 0 represents a piece without the nut and 1 stands for a piece with the nut. | Print the number of ways to break the chocolate into multiple parts so that each part would contain exactly one nut. | [
"3\n0 1 0\n",
"5\n1 0 1 0 1\n"
] | [
"1\n",
"4\n"
] | In the first sample there is exactly one nut, so the number of ways equals 1 — Bob shouldn't make any breaks.
In the second sample you can break the bar in four ways:
10|10|1
1|010|1
10|1|01
1|01|01 | 1,000 | [
{
"input": "3\n0 1 0",
"output": "1"
},
{
"input": "5\n1 0 1 0 1",
"output": "4"
},
{
"input": "10\n0 0 1 0 0 0 1 1 0 1",
"output": "8"
},
{
"input": "20\n0 0 0 0 1 1 1 0 1 0 0 1 0 1 1 0 1 1 1 0",
"output": "24"
},
{
"input": "50\n0 1 1 1 1 1 1 0 1 1 0 1 1 1 0 0 1 0 1 1 0 1 0 0 1 1 1 1 1 1 0 1 1 0 0 0 1 0 0 0 0 1 0 1 1 0 0 0 0 0",
"output": "11520"
},
{
"input": "99\n0 0 0 1 0 1 0 1 0 1 0 1 0 0 1 1 1 1 1 1 1 0 1 0 1 1 0 1 1 1 0 0 0 0 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 0 0 0 1 0 1 0 0 0 0 1 1 1 1 1 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "17694720"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "100\n1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1 0 0 1",
"output": "5559060566555523"
},
{
"input": "41\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "18\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "10\n0 1 0 0 0 0 1 0 0 1",
"output": "15"
},
{
"input": "10\n1 1 0 0 0 1 1 1 1 0",
"output": "4"
},
{
"input": "50\n1 1 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 0 1 1 1 1 0 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 1 0 1 0 0 1 0 1 1 1",
"output": "186624"
},
{
"input": "50\n0 0 1 1 0 0 0 1 0 1 1 1 0 1 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 1 0 1 1 1 1 0 1 0 1 1 0 1 1 0 0 0 1 1 0 1",
"output": "122880"
},
{
"input": "99\n1 1 1 1 0 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 1 1 0 1 0 0 0 0 1 1 1 1 1 0 0 0 1 0 1 1 1 0 0 0 0 1 0 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 0 1 0 0 1 1 0 0 0 0 1 1 1 1 1 0 1 0 0 1 1 1 0 0",
"output": "27869184000"
},
{
"input": "99\n1 0 1 1 1 1 1 1 0 1 0 0 0 0 0 1 1 0 0 1 1 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 1 0 0 0 1 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 0 0 1 0 0 1 1 1 0 1 1 0 0 1 0 1 1 1 0 1 0 0 0 1 0 1 1 0 1 0 1 1 0 0 1 0 0 1 1 1",
"output": "123834728448"
},
{
"input": "100\n1 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 1 0 0 1 0 1 1 0 0 1 0 0 1 0 0 1 1 0 0 0 1 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 1 0 0 0 0 0 1 0 1 0 1 0",
"output": "773967052800"
},
{
"input": "100\n0 1 1 0 1 1 0 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 1 1 0 1 1 1 1 0 1 0 0 1 1 1 0 0 0 0 0 1 1 0 0 0 0 0 1 0 1 0 1 0 1 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 0 0 0 1 1 1 0 1 0 1 1 1 0 1 1 0 1",
"output": "38698352640"
},
{
"input": "100\n1 1 1 0 1 0 0 0 0 0 0 0 1 1 1 0 0 1 1 1 1 1 0 0 1 0 1 1 1 1 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 1 1 1 1 1 1 0 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0",
"output": "72236924928"
},
{
"input": "100\n1 1 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 1 1 0 0 0 1 1 0 1 1 0 0 1 0 0 1 0 0 1 1 0 0 1 1 0 1 0 0 1 0 1 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 0 0 0 0 1 0 0 1 0 0 1 0 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1",
"output": "58047528960"
},
{
"input": "100\n0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 1 0 1 1 1 0 1 1 1 1 0 1 0 0 0 1 1 0 1 1 1 0 0 1 0 0 0 1 0 1 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 1 0 0 1 0 1 0 1 0 0 0 1 1 0 1 1 0 1 1 1 1 0",
"output": "73987522560"
},
{
"input": "100\n1 1 0 1 1 0 0 1 0 1 0 1 0 1 0 1 1 1 0 0 1 0 1 0 1 0 1 1 1 0 1 1 0 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 1 0 1 0 0 1 1 0 1 1 1 1 1 1 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 1 0",
"output": "180592312320"
},
{
"input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1",
"output": "1900000000"
}
] | 1,697,478,887 | 2,147,483,647 | Python 3 | OK | TESTS | 26 | 46 | 0 | input()
Q = (''.join(input().split())).split('1')
res = 1
if len(Q) == 1:
res = 0
Q = Q[1:-1]
for i in Q:
res *= len(i) + 1
print(res)
| Title: Chocolate
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bob loves everything sweet. His favorite chocolate bar consists of pieces, each piece may contain a nut. Bob wants to break the bar of chocolate into multiple pieces so that each part would contain exactly one nut and any break line goes between two adjacent pieces.
You are asked to calculate the number of ways he can do it. Two ways to break chocolate are considered distinct if one of them contains a break between some two adjacent pieces and the other one doesn't.
Please note, that if Bob doesn't make any breaks, all the bar will form one piece and it still has to have exactly one nut.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of pieces in the chocolate bar.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1), where 0 represents a piece without the nut and 1 stands for a piece with the nut.
Output Specification:
Print the number of ways to break the chocolate into multiple parts so that each part would contain exactly one nut.
Demo Input:
['3\n0 1 0\n', '5\n1 0 1 0 1\n']
Demo Output:
['1\n', '4\n']
Note:
In the first sample there is exactly one nut, so the number of ways equals 1 — Bob shouldn't make any breaks.
In the second sample you can break the bar in four ways:
10|10|1
1|010|1
10|1|01
1|01|01 | ```python
input()
Q = (''.join(input().split())).split('1')
res = 1
if len(Q) == 1:
res = 0
Q = Q[1:-1]
for i in Q:
res *= len(i) + 1
print(res)
``` | 3 |
|
208 | A | Dubstep | PROGRAMMING | 900 | [
"strings"
] | null | null | Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. | The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. | Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. | [
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] | [
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] | In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | 500 | [
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,680,586,809 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 30 | 0 | s=input()
s=s.replace("WUB", "")
b=""
for i in range(len(s)):
if(i+1!=len(s) and s[i]==s[i+1] and s[i]==" "):
continue
else:
b=b+s[i]
if(b[0]==" "):
b=b[1:]
print(b)
| Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | ```python
s=input()
s=s.replace("WUB", "")
b=""
for i in range(len(s)):
if(i+1!=len(s) and s[i]==s[i+1] and s[i]==" "):
continue
else:
b=b+s[i]
if(b[0]==" "):
b=b[1:]
print(b)
``` | 0 |
|
680 | B | Bear and Finding Criminals | PROGRAMMING | 1,000 | [
"constructive algorithms",
"implementation"
] | null | null | There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD. | The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city. | Print the number of criminals Limak will catch. | [
"6 3\n1 1 1 0 1 0\n",
"5 2\n0 0 0 1 0\n"
] | [
"3\n",
"1\n"
] | In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is. | 1,000 | [
{
"input": "6 3\n1 1 1 0 1 0",
"output": "3"
},
{
"input": "5 2\n0 0 0 1 0",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "9 3\n1 1 1 1 1 1 1 1 0",
"output": "8"
},
{
"input": "9 5\n1 0 1 0 1 0 1 0 1",
"output": "5"
},
{
"input": "20 17\n1 1 0 1 1 1 1 0 1 0 1 1 1 0 1 1 0 0 0 0",
"output": "10"
},
{
"input": "100 60\n1 1 1 1 1 1 0 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 0 1 0 0 0 1 1 1 0 1 0 0 1 1 1 0 1 1 1 0 0 1 1 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 1 1 0 1 0 0",
"output": "27"
},
{
"input": "8 1\n1 0 1 1 0 0 1 0",
"output": "4"
},
{
"input": "11 11\n0 1 0 0 1 1 1 0 0 0 0",
"output": "4"
},
{
"input": "19 10\n0 1 1 0 1 0 0 1 1 0 0 1 0 1 0 0 1 0 1",
"output": "4"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "3"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "98 70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "41"
},
{
"input": "99 70\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "99 60\n0 0 0 1 1 0 1 1 0 0 1 0 0 0 0 0 1 0 1 0 0 0 1 0 1 1 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "34"
},
{
"input": "98 24\n0 0 0 1 1 0 1 1 0 0 0 0 1 0 0 1 0 0 1 1 1 0 0 1 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 0 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 1 1 0 0 1 0 0 0 1 0 1 1 0 1 0 1 1 1 0 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 1 0 1 0 0 1 1",
"output": "39"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "2 1\n0 1",
"output": "1"
}
] | 1,686,438,359 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 30 | 0 | a,b=map(int,input().split())
x=list(map(int,input().split()))
x[b-1]=0
print(x.count(1))
| Title: Bear and Finding Criminals
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
Input Specification:
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
Output Specification:
Print the number of criminals Limak will catch.
Demo Input:
['6 3\n1 1 1 0 1 0\n', '5 2\n0 0 0 1 0\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is. | ```python
a,b=map(int,input().split())
x=list(map(int,input().split()))
x[b-1]=0
print(x.count(1))
``` | 0 |
|
136 | A | Presents | PROGRAMMING | 800 | [
"implementation"
] | null | null | Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. | Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. | [
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] | [
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] | none | 500 | [
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,682,152,808 | 2,147,483,647 | Python 3 | OK | TESTS | 101 | 124 | 0 | n = int(input())
p = list(map(int, input().split()))
r = [0] * n
for i in range(n):
r[p[i]-1] = i+1
for x in r:
print(x, end=" ")
print() | Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none | ```python
n = int(input())
p = list(map(int, input().split()))
r = [0] * n
for i in range(n):
r[p[i]-1] = i+1
for x in r:
print(x, end=" ")
print()
``` | 3 |
|
140 | C | New Year Snowmen | PROGRAMMING | 1,800 | [
"binary search",
"data structures",
"greedy"
] | null | null | As meticulous Gerald sets the table and caring Alexander sends the postcards, Sergey makes snowmen. Each showman should consist of three snowballs: a big one, a medium one and a small one. Sergey's twins help him: they've already made *n* snowballs with radii equal to *r*1, *r*2, ..., *r**n*. To make a snowman, one needs any three snowballs whose radii are pairwise different. For example, the balls with radii 1, 2 and 3 can be used to make a snowman but 2, 2, 3 or 2, 2, 2 cannot. Help Sergey and his twins to determine what maximum number of snowmen they can make from those snowballs. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of snowballs. The next line contains *n* integers — the balls' radii *r*1, *r*2, ..., *r**n* (1<=≤<=*r**i*<=≤<=109). The balls' radii can coincide. | Print on the first line a single number *k* — the maximum number of the snowmen. Next *k* lines should contain the snowmen's descriptions. The description of each snowman should consist of three space-separated numbers — the big ball's radius, the medium ball's radius and the small ball's radius. It is allowed to print the snowmen in any order. If there are several solutions, print any of them. | [
"7\n1 2 3 4 5 6 7\n",
"3\n2 2 3\n"
] | [
"2\n3 2 1\n6 5 4\n",
"0\n"
] | none | 1,500 | [
{
"input": "7\n1 2 3 4 5 6 7",
"output": "2\n7 5 3\n6 4 2"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "1\n255317",
"output": "0"
},
{
"input": "6\n1 1 2 2 3 3",
"output": "2\n3 2 1\n3 2 1"
},
{
"input": "6\n1 2 2 2 3 3",
"output": "1\n3 2 1"
},
{
"input": "6\n1 1 2 2 2 2",
"output": "0"
},
{
"input": "6\n1 2 2 3 3 3",
"output": "1\n3 2 1"
},
{
"input": "6\n1 1 1 2 2 3",
"output": "1\n3 2 1"
},
{
"input": "14\n1 1 2 2 3 3 4 4 4 4 5 5 5 5",
"output": "4\n5 4 3\n5 4 3\n5 4 2\n5 4 2"
},
{
"input": "20\n8 2 9 1 1 4 7 3 8 3 9 4 5 1 9 7 1 6 8 8",
"output": "6\n9 8 4\n9 7 3\n9 7 3\n8 6 2\n8 5 1\n8 4 1"
},
{
"input": "20\n1 3 2 2 1 2 3 4 2 4 4 3 1 4 2 1 3 1 4 4",
"output": "6\n4 3 2\n4 3 2\n4 3 2\n4 3 1\n4 2 1\n4 2 1"
},
{
"input": "20\n4 2 2 2 5 2 4 2 2 3 5 2 1 3 1 2 2 5 4 3",
"output": "5\n5 4 2\n5 3 2\n5 3 2\n4 3 2\n4 2 1"
},
{
"input": "20\n7 6 6 7 2 2 2 2 2 6 1 5 3 4 5 7 1 6 1 4",
"output": "6\n7 6 2\n7 5 2\n7 5 2\n6 4 2\n6 4 2\n6 3 1"
},
{
"input": "20\n15 3 8 5 13 4 8 6 8 7 5 10 14 16 1 3 6 16 9 16",
"output": "6\n16 10 6\n16 9 6\n16 8 5\n15 8 5\n14 8 4\n13 7 3"
},
{
"input": "2\n25 37",
"output": "0"
},
{
"input": "12\n1 1 1 2 2 2 3 3 3 4 4 4",
"output": "4\n4 3 2\n4 3 1\n4 2 1\n3 2 1"
},
{
"input": "12\n1 1 1 2 2 2 3 3 3 4 4 5",
"output": "4\n5 3 2\n4 3 1\n4 2 1\n3 2 1"
},
{
"input": "12\n4 4 4 3 3 3 2 2 2 1 1 1",
"output": "4\n4 3 2\n4 3 1\n4 2 1\n3 2 1"
},
{
"input": "40\n1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4",
"output": "13\n4 3 2\n4 3 2\n4 3 2\n4 3 2\n4 3 1\n4 3 1\n4 3 1\n4 2 1\n4 2 1\n4 2 1\n3 2 1\n3 2 1\n3 2 1"
},
{
"input": "12\n2 2 2 3 3 3 4 4 4 5 5 5",
"output": "4\n5 4 3\n5 4 2\n5 3 2\n4 3 2"
},
{
"input": "20\n1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 4 4 4 4 4",
"output": "6\n4 3 2\n4 3 2\n4 3 2\n4 3 1\n4 2 1\n3 2 1"
},
{
"input": "12\n1 1 1 2 2 2 3 3 3 3 4 4",
"output": "4\n4 3 2\n4 3 1\n3 2 1\n3 2 1"
},
{
"input": "6\n1 2 2 3 4 5",
"output": "2\n5 3 2\n4 2 1"
},
{
"input": "14\n1 1 1 1 1 2 3 4 6 5 5 5 5 5",
"output": "4\n6 5 1\n5 4 1\n5 3 1\n5 2 1"
},
{
"input": "6\n1 1 2 3 4 5",
"output": "2\n5 3 1\n4 2 1"
}
] | 1,694,536,592 | 2,147,483,647 | PyPy 3 | OK | TESTS | 51 | 1,090 | 19,558,400 | from collections import Counter
from heapq import heappop, heappush, heapify
n=int(input());A=list(map(int,input().split()));z=Counter(A);A=list(set(A));A.sort(reverse=True);t=0;p=len(A)
if p<3:print(0)
else:
Heap=[];Ans=[]
for i in A:
Heap.append((-z[i],i))
heapify(Heap)
while len(Heap)>2:
a=heappop(Heap); b=heappop(Heap); c=heappop(Heap)
Ans.append(sorted([a[1],b[1],c[1]])[::-1])
if a[0]+1!=0:heappush(Heap,(a[0]+1,a[1]))
if b[0]+1!=0:heappush(Heap,(b[0]+1,b[1]))
if c[0]+1!=0:heappush(Heap,(c[0]+1,c[1]))
print(len(Ans))
for i in Ans:print(*i)
| Title: New Year Snowmen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As meticulous Gerald sets the table and caring Alexander sends the postcards, Sergey makes snowmen. Each showman should consist of three snowballs: a big one, a medium one and a small one. Sergey's twins help him: they've already made *n* snowballs with radii equal to *r*1, *r*2, ..., *r**n*. To make a snowman, one needs any three snowballs whose radii are pairwise different. For example, the balls with radii 1, 2 and 3 can be used to make a snowman but 2, 2, 3 or 2, 2, 2 cannot. Help Sergey and his twins to determine what maximum number of snowmen they can make from those snowballs.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of snowballs. The next line contains *n* integers — the balls' radii *r*1, *r*2, ..., *r**n* (1<=≤<=*r**i*<=≤<=109). The balls' radii can coincide.
Output Specification:
Print on the first line a single number *k* — the maximum number of the snowmen. Next *k* lines should contain the snowmen's descriptions. The description of each snowman should consist of three space-separated numbers — the big ball's radius, the medium ball's radius and the small ball's radius. It is allowed to print the snowmen in any order. If there are several solutions, print any of them.
Demo Input:
['7\n1 2 3 4 5 6 7\n', '3\n2 2 3\n']
Demo Output:
['2\n3 2 1\n6 5 4\n', '0\n']
Note:
none | ```python
from collections import Counter
from heapq import heappop, heappush, heapify
n=int(input());A=list(map(int,input().split()));z=Counter(A);A=list(set(A));A.sort(reverse=True);t=0;p=len(A)
if p<3:print(0)
else:
Heap=[];Ans=[]
for i in A:
Heap.append((-z[i],i))
heapify(Heap)
while len(Heap)>2:
a=heappop(Heap); b=heappop(Heap); c=heappop(Heap)
Ans.append(sorted([a[1],b[1],c[1]])[::-1])
if a[0]+1!=0:heappush(Heap,(a[0]+1,a[1]))
if b[0]+1!=0:heappush(Heap,(b[0]+1,b[1]))
if c[0]+1!=0:heappush(Heap,(c[0]+1,c[1]))
print(len(Ans))
for i in Ans:print(*i)
``` | 3 |
|
669 | A | Little Artem and Presents | PROGRAMMING | 800 | [
"math"
] | null | null | Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha? | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday. | Print the maximum possible number of times Artem can give presents to Masha. | [
"1\n",
"2\n",
"3\n",
"4\n"
] | [
"1\n",
"1\n",
"2\n",
"3\n"
] | In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again. | 500 | [
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "3"
},
{
"input": "100",
"output": "67"
},
{
"input": "101",
"output": "67"
},
{
"input": "102",
"output": "68"
},
{
"input": "1000000000",
"output": "666666667"
},
{
"input": "5",
"output": "3"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "666666666"
},
{
"input": "999999998",
"output": "666666665"
},
{
"input": "999999997",
"output": "666666665"
},
{
"input": "999999996",
"output": "666666664"
},
{
"input": "999999995",
"output": "666666663"
},
{
"input": "999999994",
"output": "666666663"
},
{
"input": "999999993",
"output": "666666662"
},
{
"input": "999999992",
"output": "666666661"
},
{
"input": "999999991",
"output": "666666661"
},
{
"input": "1000",
"output": "667"
},
{
"input": "10000",
"output": "6667"
},
{
"input": "100000",
"output": "66667"
},
{
"input": "1000000",
"output": "666667"
},
{
"input": "10000000",
"output": "6666667"
},
{
"input": "100000000",
"output": "66666667"
},
{
"input": "7",
"output": "5"
}
] | 1,587,635,459 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 109 | 0 | n = int(input())
if(n==1 or n ==2):
print(1)
if(n ==3):
print(2)
else:
print(int(n/2)+1)
| Title: Little Artem and Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Output Specification:
Print the maximum possible number of times Artem can give presents to Masha.
Demo Input:
['1\n', '2\n', '3\n', '4\n']
Demo Output:
['1\n', '1\n', '2\n', '3\n']
Note:
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again. | ```python
n = int(input())
if(n==1 or n ==2):
print(1)
if(n ==3):
print(2)
else:
print(int(n/2)+1)
``` | 0 |
|
228 | A | Is your horseshoe on the other hoof? | PROGRAMMING | 800 | [
"implementation"
] | null | null | Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. | The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers. | Print a single integer — the minimum number of horseshoes Valera needs to buy. | [
"1 7 3 3\n",
"7 7 7 7\n"
] | [
"1\n",
"3\n"
] | none | 500 | [
{
"input": "1 7 3 3",
"output": "1"
},
{
"input": "7 7 7 7",
"output": "3"
},
{
"input": "81170865 673572653 756938629 995577259",
"output": "0"
},
{
"input": "3491663 217797045 522540872 715355328",
"output": "0"
},
{
"input": "251590420 586975278 916631563 586975278",
"output": "1"
},
{
"input": "259504825 377489979 588153796 377489979",
"output": "1"
},
{
"input": "652588203 931100304 931100304 652588203",
"output": "2"
},
{
"input": "391958720 651507265 391958720 651507265",
"output": "2"
},
{
"input": "90793237 90793237 90793237 90793237",
"output": "3"
},
{
"input": "551651653 551651653 551651653 551651653",
"output": "3"
},
{
"input": "156630260 609654355 668943582 973622757",
"output": "0"
},
{
"input": "17061017 110313588 434481173 796661222",
"output": "0"
},
{
"input": "24975422 256716298 337790533 690960249",
"output": "0"
},
{
"input": "255635360 732742923 798648949 883146723",
"output": "0"
},
{
"input": "133315691 265159773 734556507 265159773",
"output": "1"
},
{
"input": "28442865 741657755 978106882 978106882",
"output": "1"
},
{
"input": "131245479 174845575 497483467 131245479",
"output": "1"
},
{
"input": "139159884 616215581 958341883 616215581",
"output": "1"
},
{
"input": "147784432 947653080 947653080 947653080",
"output": "2"
},
{
"input": "94055790 756126496 756126496 94055790",
"output": "2"
},
{
"input": "240458500 511952208 240458500 511952208",
"output": "2"
},
{
"input": "681828506 972810624 972810624 681828506",
"output": "2"
},
{
"input": "454961014 454961014 454961014 454961014",
"output": "3"
},
{
"input": "915819430 915819430 915819430 915819430",
"output": "3"
},
{
"input": "671645142 671645142 671645142 671645142",
"output": "3"
},
{
"input": "132503558 132503558 132503558 132503558",
"output": "3"
},
{
"input": "5 5 999999 6",
"output": "1"
},
{
"input": "1 1 2 5",
"output": "1"
},
{
"input": "2 1 2 3",
"output": "1"
},
{
"input": "1 1 3 5",
"output": "1"
},
{
"input": "1 1 3 3",
"output": "2"
},
{
"input": "2 2 2 1",
"output": "2"
},
{
"input": "3 1 1 1",
"output": "2"
},
{
"input": "1 2 2 2",
"output": "2"
}
] | 1,694,538,377 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 92 | 0 | s1, s2, s3, s4 = map(int, input().split())
colors = set([s1, s2, s3, s4])
additional=4-len(colors)
print(additional)
| Title: Is your horseshoe on the other hoof?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
Input Specification:
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
Output Specification:
Print a single integer — the minimum number of horseshoes Valera needs to buy.
Demo Input:
['1 7 3 3\n', '7 7 7 7\n']
Demo Output:
['1\n', '3\n']
Note:
none | ```python
s1, s2, s3, s4 = map(int, input().split())
colors = set([s1, s2, s3, s4])
additional=4-len(colors)
print(additional)
``` | 3 |
|
12 | A | Super Agent | PROGRAMMING | 800 | [
"implementation"
] | A. Super Agent | 2 | 256 | There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations. | Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.». | Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise. | [
"XX.\n...\n.XX\n",
"X.X\nX..\n...\n"
] | [
"YES\n",
"NO\n"
] | If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry | 0 | [
{
"input": "XX.\n...\n.XX",
"output": "YES"
},
{
"input": ".X.\n.X.\n.X.",
"output": "YES"
},
{
"input": "XXX\nXXX\nXXX",
"output": "YES"
},
{
"input": "XXX\nX.X\nXXX",
"output": "YES"
},
{
"input": "X..\n.X.\n..X",
"output": "YES"
},
{
"input": "...\nX.X\nX..",
"output": "NO"
},
{
"input": ".X.\nX.X\n.X.",
"output": "YES"
},
{
"input": "X.X\n.X.\nX.X",
"output": "YES"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "XXX\n...\nXXX",
"output": "YES"
},
{
"input": "..X\nX..\n..X",
"output": "NO"
},
{
"input": ".X.\n...\nX.X",
"output": "NO"
},
{
"input": "X.X\nX.X\nX.X",
"output": "YES"
},
{
"input": ".X.\nX.X\nXX.",
"output": "NO"
},
{
"input": "...\nXXX\nXXX",
"output": "NO"
},
{
"input": "XXX\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX.X\n.X.",
"output": "NO"
},
{
"input": "...\n..X\nXXX",
"output": "NO"
},
{
"input": "..X\nX.X\nX..",
"output": "YES"
},
{
"input": "..X\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX..\nX..",
"output": "NO"
},
{
"input": "XXX\n.X.\nXXX",
"output": "YES"
},
{
"input": "..X\n...\nX..",
"output": "YES"
},
{
"input": "...\n...\nX..",
"output": "NO"
},
{
"input": "...\n...\n.X.",
"output": "NO"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "...\n.X.\nX..",
"output": "NO"
}
] | 1,666,365,688 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 60 | 0 | s=[]
for i in range(3):
a=input()
s.append(a[0])
s.append(a[1])
s.append(a[2])
if s[0]==s[8]:
print("YES")
elif s[1]==s[7]:
print("YES")
elif s[2]==s[6]:
print("YES")
elif s[3]==s[5]:
print("YES")
else:
print("NO") | Title: Super Agent
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input Specification:
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Output Specification:
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
Demo Input:
['XX.\n...\n.XX\n', 'X.X\nX..\n...\n']
Demo Output:
['YES\n', 'NO\n']
Note:
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry | ```python
s=[]
for i in range(3):
a=input()
s.append(a[0])
s.append(a[1])
s.append(a[2])
if s[0]==s[8]:
print("YES")
elif s[1]==s[7]:
print("YES")
elif s[2]==s[6]:
print("YES")
elif s[3]==s[5]:
print("YES")
else:
print("NO")
``` | 0 |
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,691,772,565 | 2,147,483,647 | PyPy 3-64 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | def split_arbuza(w):
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]) != w:
return "NO"
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) == w:
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) > 0.5:
return "YES"
else:
return "NO"
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) > 0.5:
return "YES"
else:
return "NO" | Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
def split_arbuza(w):
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]) != w:
return "NO"
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) == w:
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) > 0.5:
return "YES"
else:
return "NO"
if sum([weight for weight in [x for x in range(1, w+1) if x % 2 == 0]]) > 0.5:
return "YES"
else:
return "NO"
``` | -1 |
200 | B | Drinks | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space. | Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4. | [
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] | [
"66.666666666667\n",
"37.500000000000\n"
] | Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent. | 500 | [
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,694,883,768 | 2,147,483,647 | Python 3 | OK | TESTS | 31 | 92 | 0 | number = int(input())
sum_number = 0
for i in input().split():
i = int(i)
sum_number += i
result = sum_number/number
print('%.12f' %result) | Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent. | ```python
number = int(input())
sum_number = 0
for i in input().split():
i = int(i)
sum_number += i
result = sum_number/number
print('%.12f' %result)
``` | 3 |
|
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,620,052,815 | 2,147,483,647 | Python 3 | OK | TESTS | 81 | 154 | 0 | n=int(input())
x=0
y=0
z=0
for i in range(n):
a,b,c=map(int,input().split())
x+=a
y+=b
z+=c
if x==y==z==0:
print("YES")
else:
print("NO")
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
n=int(input())
x=0
y=0
z=0
for i in range(n):
a,b,c=map(int,input().split())
x+=a
y+=b
z+=c
if x==y==z==0:
print("YES")
else:
print("NO")
``` | 3.9615 |
320 | A | Magic Numbers | PROGRAMMING | 900 | [
"brute force",
"greedy"
] | null | null | A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not. | The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros. | Print "YES" if *n* is a magic number or print "NO" if it's not. | [
"114114\n",
"1111\n",
"441231\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,668,712,474 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 7 | 92 | 0 | s= input()
s1= s.strip("144")
s2= s1.strip("14")
s3= s2.strip("1")
if s3== "":
print("YES")
else:
print("NO") | Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none | ```python
s= input()
s1= s.strip("144")
s2= s1.strip("14")
s3= s2.strip("1")
if s3== "":
print("YES")
else:
print("NO")
``` | 0 |
|
47 | A | Triangular numbers | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Triangular numbers | 2 | 256 | A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number. | The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer. | If the given integer is a triangular number output YES, otherwise output NO. | [
"1\n",
"2\n",
"3\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | none | 500 | [
{
"input": "1",
"output": "YES"
},
{
"input": "2",
"output": "NO"
},
{
"input": "3",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "5",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "7",
"output": "NO"
},
{
"input": "8",
"output": "NO"
},
{
"input": "12",
"output": "NO"
},
{
"input": "10",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "9",
"output": "NO"
},
{
"input": "14",
"output": "NO"
},
{
"input": "15",
"output": "YES"
},
{
"input": "16",
"output": "NO"
},
{
"input": "20",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "22",
"output": "NO"
},
{
"input": "121",
"output": "NO"
},
{
"input": "135",
"output": "NO"
},
{
"input": "136",
"output": "YES"
},
{
"input": "137",
"output": "NO"
},
{
"input": "152",
"output": "NO"
},
{
"input": "153",
"output": "YES"
},
{
"input": "154",
"output": "NO"
},
{
"input": "171",
"output": "YES"
},
{
"input": "189",
"output": "NO"
},
{
"input": "190",
"output": "YES"
},
{
"input": "191",
"output": "NO"
},
{
"input": "210",
"output": "YES"
},
{
"input": "211",
"output": "NO"
},
{
"input": "231",
"output": "YES"
},
{
"input": "232",
"output": "NO"
},
{
"input": "252",
"output": "NO"
},
{
"input": "253",
"output": "YES"
},
{
"input": "254",
"output": "NO"
},
{
"input": "275",
"output": "NO"
},
{
"input": "276",
"output": "YES"
},
{
"input": "277",
"output": "NO"
},
{
"input": "299",
"output": "NO"
},
{
"input": "300",
"output": "YES"
},
{
"input": "301",
"output": "NO"
},
{
"input": "324",
"output": "NO"
},
{
"input": "325",
"output": "YES"
},
{
"input": "326",
"output": "NO"
},
{
"input": "350",
"output": "NO"
},
{
"input": "351",
"output": "YES"
},
{
"input": "352",
"output": "NO"
},
{
"input": "377",
"output": "NO"
},
{
"input": "378",
"output": "YES"
},
{
"input": "406",
"output": "YES"
},
{
"input": "434",
"output": "NO"
},
{
"input": "435",
"output": "YES"
},
{
"input": "464",
"output": "NO"
},
{
"input": "465",
"output": "YES"
},
{
"input": "495",
"output": "NO"
},
{
"input": "496",
"output": "YES"
},
{
"input": "497",
"output": "NO"
},
{
"input": "331",
"output": "NO"
},
{
"input": "413",
"output": "NO"
},
{
"input": "177",
"output": "NO"
},
{
"input": "122",
"output": "NO"
},
{
"input": "478",
"output": "NO"
},
{
"input": "188",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "474",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "48",
"output": "NO"
},
{
"input": "498",
"output": "NO"
},
{
"input": "499",
"output": "NO"
},
{
"input": "500",
"output": "NO"
}
] | 1,488,058,889 | 2,147,483,647 | Python 3 | OK | TESTS | 71 | 124 | 4,608,000 |
def main():
n = int(input())
a = []
i = 1
while(i < 50):
a.append(i * (i + 1) // 2)
i += 1
fnd = False
for i in a:
if i == n :
fnd = True
break
print("YES" if fnd == True else "NO")
if __name__ == "__main__": main() | Title: Triangular numbers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number.
Input Specification:
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
Output Specification:
If the given integer is a triangular number output YES, otherwise output NO.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none | ```python
def main():
n = int(input())
a = []
i = 1
while(i < 50):
a.append(i * (i + 1) // 2)
i += 1
fnd = False
for i in a:
if i == n :
fnd = True
break
print("YES" if fnd == True else "NO")
if __name__ == "__main__": main()
``` | 3.960417 |
722 | A | Broken Clock | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | You are given a broken clock. You know, that it is supposed to show time in 12- or 24-hours HH:MM format. In 12-hours format hours change from 1 to 12, while in 24-hours it changes from 0 to 23. In both formats minutes change from 0 to 59.
You are given a time in format HH:MM that is currently displayed on the broken clock. Your goal is to change minimum number of digits in order to make clocks display the correct time in the given format.
For example, if 00:99 is displayed, it is enough to replace the second 9 with 3 in order to get 00:39 that is a correct time in 24-hours format. However, to make 00:99 correct in 12-hours format, one has to change at least two digits. Additionally to the first change one can replace the second 0 with 1 and obtain 01:39. | The first line of the input contains one integer 12 or 24, that denote 12-hours or 24-hours format respectively.
The second line contains the time in format HH:MM, that is currently displayed on the clock. First two characters stand for the hours, while next two show the minutes. | The only line of the output should contain the time in format HH:MM that is a correct time in the given format. It should differ from the original in as few positions as possible. If there are many optimal solutions you can print any of them. | [
"24\n17:30\n",
"12\n17:30\n",
"24\n99:99\n"
] | [
"17:30\n",
"07:30\n",
"09:09\n"
] | none | 500 | [
{
"input": "24\n17:30",
"output": "17:30"
},
{
"input": "12\n17:30",
"output": "07:30"
},
{
"input": "24\n99:99",
"output": "09:09"
},
{
"input": "12\n05:54",
"output": "05:54"
},
{
"input": "12\n00:05",
"output": "01:05"
},
{
"input": "24\n23:80",
"output": "23:00"
},
{
"input": "24\n73:16",
"output": "03:16"
},
{
"input": "12\n03:77",
"output": "03:07"
},
{
"input": "12\n47:83",
"output": "07:03"
},
{
"input": "24\n23:88",
"output": "23:08"
},
{
"input": "24\n51:67",
"output": "01:07"
},
{
"input": "12\n10:33",
"output": "10:33"
},
{
"input": "12\n00:01",
"output": "01:01"
},
{
"input": "12\n07:74",
"output": "07:04"
},
{
"input": "12\n00:60",
"output": "01:00"
},
{
"input": "24\n08:32",
"output": "08:32"
},
{
"input": "24\n42:59",
"output": "02:59"
},
{
"input": "24\n19:87",
"output": "19:07"
},
{
"input": "24\n26:98",
"output": "06:08"
},
{
"input": "12\n12:91",
"output": "12:01"
},
{
"input": "12\n11:30",
"output": "11:30"
},
{
"input": "12\n90:32",
"output": "10:32"
},
{
"input": "12\n03:69",
"output": "03:09"
},
{
"input": "12\n33:83",
"output": "03:03"
},
{
"input": "24\n10:45",
"output": "10:45"
},
{
"input": "24\n65:12",
"output": "05:12"
},
{
"input": "24\n22:64",
"output": "22:04"
},
{
"input": "24\n48:91",
"output": "08:01"
},
{
"input": "12\n02:51",
"output": "02:51"
},
{
"input": "12\n40:11",
"output": "10:11"
},
{
"input": "12\n02:86",
"output": "02:06"
},
{
"input": "12\n99:96",
"output": "09:06"
},
{
"input": "24\n19:24",
"output": "19:24"
},
{
"input": "24\n55:49",
"output": "05:49"
},
{
"input": "24\n01:97",
"output": "01:07"
},
{
"input": "24\n39:68",
"output": "09:08"
},
{
"input": "24\n24:00",
"output": "04:00"
},
{
"input": "12\n91:00",
"output": "01:00"
},
{
"input": "24\n00:30",
"output": "00:30"
},
{
"input": "12\n13:20",
"output": "03:20"
},
{
"input": "12\n13:00",
"output": "03:00"
},
{
"input": "12\n42:35",
"output": "02:35"
},
{
"input": "12\n20:00",
"output": "10:00"
},
{
"input": "12\n21:00",
"output": "01:00"
},
{
"input": "24\n10:10",
"output": "10:10"
},
{
"input": "24\n30:40",
"output": "00:40"
},
{
"input": "24\n12:00",
"output": "12:00"
},
{
"input": "12\n10:60",
"output": "10:00"
},
{
"input": "24\n30:00",
"output": "00:00"
},
{
"input": "24\n34:00",
"output": "04:00"
},
{
"input": "12\n22:00",
"output": "02:00"
},
{
"input": "12\n20:20",
"output": "10:20"
}
] | 1,475,333,549 | 2,849 | Python 3 | WRONG_ANSWER | PRETESTS | 0 | 31 | 0 | n=int(input());
x=input();
h=int(x[:2]);
m=int(x[3:]);
ans=0;
if(m>=60):
ans+=1;
if(n==12):
if(h<1 or h>12):
ans+=1;
if(n==24):
if(h>23):
ans+=1; | Title: Broken Clock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a broken clock. You know, that it is supposed to show time in 12- or 24-hours HH:MM format. In 12-hours format hours change from 1 to 12, while in 24-hours it changes from 0 to 23. In both formats minutes change from 0 to 59.
You are given a time in format HH:MM that is currently displayed on the broken clock. Your goal is to change minimum number of digits in order to make clocks display the correct time in the given format.
For example, if 00:99 is displayed, it is enough to replace the second 9 with 3 in order to get 00:39 that is a correct time in 24-hours format. However, to make 00:99 correct in 12-hours format, one has to change at least two digits. Additionally to the first change one can replace the second 0 with 1 and obtain 01:39.
Input Specification:
The first line of the input contains one integer 12 or 24, that denote 12-hours or 24-hours format respectively.
The second line contains the time in format HH:MM, that is currently displayed on the clock. First two characters stand for the hours, while next two show the minutes.
Output Specification:
The only line of the output should contain the time in format HH:MM that is a correct time in the given format. It should differ from the original in as few positions as possible. If there are many optimal solutions you can print any of them.
Demo Input:
['24\n17:30\n', '12\n17:30\n', '24\n99:99\n']
Demo Output:
['17:30\n', '07:30\n', '09:09\n']
Note:
none | ```python
n=int(input());
x=input();
h=int(x[:2]);
m=int(x[3:]);
ans=0;
if(m>=60):
ans+=1;
if(n==12):
if(h<1 or h>12):
ans+=1;
if(n==24):
if(h>23):
ans+=1;
``` | 0 |
|
5 | A | Chat Servers Outgoing Traffic | PROGRAMMING | 1,000 | [
"implementation"
] | A. Chat Server's Outgoing Traffic | 1 | 64 | Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem. | Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive. | Print a single number — answer to the problem. | [
"+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n",
"+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n"
] | [
"9\n",
"14\n"
] | none | 0 | [
{
"input": "+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate",
"output": "9"
},
{
"input": "+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate",
"output": "14"
},
{
"input": "+Dmitry\n+Mike\nDmitry:All letters will be used\nDmitry:qwertyuiopasdfghjklzxcvbnm QWERTYUIOPASDFGHJKLZXCVBNM\nDmitry:And digits too\nDmitry:1234567890 0987654321\n-Dmitry",
"output": "224"
},
{
"input": "+Dmitry\n+Mike\n+Kate\nDmitry:",
"output": "0"
},
{
"input": "+Dmitry\nDmitry:No phrases with spaces at the beginning and at the end\n+Mike\nDmitry:spaces spaces\n-Dmitry",
"output": "86"
},
{
"input": "+XqD\n+aT537\nXqD:x6ZPjMR1DDKG2\nXqD:lLCriywPnB\n-XqD",
"output": "46"
},
{
"input": "+8UjgAJ\n8UjgAJ:02hR7UBc1tqqfL\n-8UjgAJ\n+zdi\n-zdi",
"output": "14"
},
{
"input": "+6JPKkgXDrA\n+j6JHjv70An\n+QGtsceK0zJ\n6JPKkgXDrA:o4\n+CSmwi9zDra\nQGtsceK0zJ:Zl\nQGtsceK0zJ:0\nj6JHjv70An:7\nj6JHjv70An:B\nQGtsceK0zJ:OO",
"output": "34"
},
{
"input": "+1aLNq9S7uLV\n-1aLNq9S7uLV\n+O9ykq3xDJv\n-O9ykq3xDJv\n+54Yq1xJq14F\n+0zJ5Vo0RDZ\n-54Yq1xJq14F\n-0zJ5Vo0RDZ\n+lxlH7sdolyL\n-lxlH7sdolyL",
"output": "0"
},
{
"input": "+qlHEc2AuYy\nqlHEc2AuYy:YYRwD0 edNZgpE nGfOguRWnMYpTpGUVM aXDKGXo1Gv1tHL9\nqlHEc2AuYy:yvh3GsPcImqrvoUcBNQcP6ezwpU0 xAVltaKZp94VKiNao\nqlHEc2AuYy:zuCO6Opey L eu7lTwysaSk00zjpv zrDfbt8l hpHfu\n+pErDMxgVgh\nqlHEc2AuYy:I1FLis mmQbZtd8Ui7y 1vcax6yZBMhVRdD6Ahlq7MNCw\nqlHEc2AuYy:lz MFUNJZhlqBYckHUDlNhLiEkmecRh1o0t7alXBvCRVEFVx\npErDMxgVgh:jCyMbu1dkuEj5TzbBOjyUhpfC50cL8R900Je3R KxRgAI dT\nqlHEc2AuYy:62b47eabo2hf vSUD7KioN ZHki6WB6gh3u GKv5rgwyfF\npErDMxgVgh:zD5 9 ympl4wR gy7a7eAGAn5xVdGP9FbL6hRCZAR6O4pT6zb",
"output": "615"
},
{
"input": "+adabacaba0",
"output": "0"
},
{
"input": "+acabadab\n+caba0aba",
"output": "0"
},
{
"input": "+dabaca\n-dabaca\n+aba0ab",
"output": "0"
},
{
"input": "+cab\n+abac\n-abac\n+baca",
"output": "0"
},
{
"input": "+cabadabac\n-cabadabac\n+abacaba1ab\n-abacaba1ab\n+ba0abaca",
"output": "0"
},
{
"input": "+adabacaba\n-adabacaba\n+aca\naca:caba\n-aca\n+bacaba\n-bacaba\n+aba\n-aba\n+bad",
"output": "4"
},
{
"input": "+acabadab\n-acabadab\n+aba0abacab\n+baca\n+abacaba0ab\n-baca\n-abacaba0ab\n-aba0abacab\n+cab\n-cab\n+abacabada\n-abacabada\n+badabaca\n-badabaca\n+badaba",
"output": "0"
},
{
"input": "+badabac\nbadabac:abacabad\n-badabac\n+0ab\n-0ab\n+dabacab\n-dabacab\n+a0ab\n-a0ab\n+0abaca\n-0abaca\n+dabac\n-dabac\n+abaca\n-abaca\n+bacabada\n-bacabada\n+aca\n-aca\n+abadabaca\n-abadabaca\n+acaba\n-acaba\n+abacabadab\n-abacabadab",
"output": "8"
}
] | 1,587,221,547 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 156 | 204,800 | #исходящий трафик чата
arr=[]
cnt=0
s=input().split('\n')
for i in range(len(s)):
if ord(s[i][0]) == 43:
index = 0
s[i] = s[i][:index] + s[i][index+1:]
arr.append(s[i])
elif ord(s[i][0]) == 45:
index = 0
s[i] = s[i][:index] + s[i][index+1:]
arr.remove(s[i])
elif s[i].split(':')[0] in arr:
cnt+=(len(s[i].split(':')[1])*len(arr))
#print(arr)
print(cnt)
| Title: Chat Servers Outgoing Traffic
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
Input Specification:
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output Specification:
Print a single number — answer to the problem.
Demo Input:
['+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n', '+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n']
Demo Output:
['9\n', '14\n']
Note:
none | ```python
#исходящий трафик чата
arr=[]
cnt=0
s=input().split('\n')
for i in range(len(s)):
if ord(s[i][0]) == 43:
index = 0
s[i] = s[i][:index] + s[i][index+1:]
arr.append(s[i])
elif ord(s[i][0]) == 45:
index = 0
s[i] = s[i][:index] + s[i][index+1:]
arr.remove(s[i])
elif s[i].split(':')[0] in arr:
cnt+=(len(s[i].split(':')[1])*len(arr))
#print(arr)
print(cnt)
``` | 0 |
48 | D | Permutations | PROGRAMMING | 1,500 | [
"greedy"
] | D. Permutations | 1 | 256 | A permutation is a sequence of integers from 1 to *n* of length *n* containing each number exactly once. For example, (1), (4,<=3,<=5,<=1,<=2), (3,<=2,<=1) are permutations, and (1,<=1), (4,<=3,<=1), (2,<=3,<=4) are not.
There are many tasks on permutations. Today you are going to solve one of them. Let’s imagine that somebody took several permutations (perhaps, with a different number of elements), wrote them down consecutively as one array and then shuffled the resulting array. The task is to restore the initial permutations if it is possible. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The next line contains the mixed array of *n* integers, divided with a single space. The numbers in the array are from 1 to 105. | If this array can be split into several permutations so that every element of the array belongs to exactly one permutation, print in the first line the number of permutations. The second line should contain *n* numbers, corresponding to the elements of the given array. If the *i*-th element belongs to the first permutation, the *i*-th number should be 1, if it belongs to the second one, then its number should be 2 and so on. The order of the permutations’ numbering is free.
If several solutions are possible, print any one of them. If there’s no solution, print in the first line <=-<=1. | [
"9\n1 2 3 1 2 1 4 2 5\n",
"4\n4 3 2 1\n",
"4\n1 2 2 3\n"
] | [
"3\n3 1 2 1 2 2 2 3 2\n",
"1\n1 1 1 1 ",
"-1\n"
] | In the first sample test the array is split into three permutations: (2, 1), (3, 2, 1, 4, 5), (1, 2). The first permutation is formed by the second and the fourth elements of the array, the second one — by the third, the fifth, the sixth, the seventh and the ninth elements, the third one — by the first and the eigth elements. Clearly, there are other splitting variants possible. | 0 | [
{
"input": "9\n1 2 3 1 2 1 4 2 5",
"output": "3\n1 1 1 2 2 3 1 3 1 "
},
{
"input": "4\n4 3 2 1",
"output": "1\n1 1 1 1 "
},
{
"input": "4\n1 2 2 3",
"output": "-1"
},
{
"input": "1\n1",
"output": "1\n1 "
},
{
"input": "1\n2",
"output": "-1"
},
{
"input": "5\n1 1 1 1 1",
"output": "5\n1 2 3 4 5 "
},
{
"input": "3\n2 1 1",
"output": "2\n1 1 2 "
},
{
"input": "6\n3 3 2 2 1 1",
"output": "2\n1 2 1 2 1 2 "
},
{
"input": "2\n1000 1",
"output": "-1"
},
{
"input": "5\n2 2 1 1 3",
"output": "2\n1 2 1 2 1 "
},
{
"input": "10\n2 1 2 4 6 1 5 3 7 1",
"output": "3\n1 1 2 1 1 2 1 1 1 3 "
},
{
"input": "10\n4 1 2 1 3 3 1 2 2 1",
"output": "4\n1 1 1 2 1 2 3 2 3 4 "
},
{
"input": "10\n1 2 5 1 1 1 4 1 3 2",
"output": "5\n1 1 1 2 3 4 1 5 1 2 "
},
{
"input": "20\n2 7 3 8 4 6 3 7 6 4 13 5 1 12 1 10 2 11 5 9",
"output": "2\n1 1 1 1 1 1 2 2 2 2 1 1 1 1 2 1 2 1 2 1 "
},
{
"input": "20\n1 1 1 2 3 1 5 9 5 8 4 6 7 3 1 2 2 1 3 4",
"output": "6\n1 2 3 1 1 4 1 1 2 1 1 1 1 2 5 2 3 6 3 2 "
},
{
"input": "20\n2 10 3 3 2 1 14 13 2 15 1 4 5 12 7 11 9 1 6 8",
"output": "3\n1 1 1 2 2 1 1 1 3 1 2 1 1 1 1 1 1 3 1 1 "
},
{
"input": "20\n1 7 2 3 1 1 8 1 6 1 9 11 5 10 1 4 2 3 1 2",
"output": "7\n1 1 1 1 2 3 1 4 1 5 1 1 1 1 6 1 2 2 7 3 "
},
{
"input": "30\n6 1 2 3 6 4 1 8 1 2 2 5 5 1 1 3 9 1 5 8 1 2 7 7 4 3 1 3 4 2",
"output": "8\n1 1 1 1 2 1 2 1 3 2 3 1 2 4 5 2 1 6 3 2 7 4 1 2 2 3 8 4 3 5 "
},
{
"input": "30\n2 6 2 3 3 1 4 2 1 3 3 2 1 2 1 8 1 2 4 1 1 1 5 1 4 7 1 9 1 1",
"output": "12\n1 1 2 1 2 1 1 3 2 3 4 4 3 5 4 1 5 6 2 6 7 8 1 9 3 1 10 1 11 12 "
},
{
"input": "30\n1 3 2 5 9 4 16 14 2 2 4 11 7 17 1 15 13 3 6 12 6 19 8 1 20 5 18 4 10 3",
"output": "3\n1 1 1 1 1 1 1 1 2 3 2 1 1 1 2 1 1 2 1 1 2 1 1 3 1 2 1 3 1 3 "
},
{
"input": "10\n2 2 6 3 1 4 5 3 7 7",
"output": "-1"
},
{
"input": "20\n4 6 6 4 5 4 3 2 5 7 3 2 4 1 3 1 1 4 1 7",
"output": "-1"
},
{
"input": "30\n2 8 3 3 7 4 2 9 4 3 5 6 1 5 3 5 8 1 9 6 6 7 2 7 1 1 1 10 2 1",
"output": "-1"
},
{
"input": "30\n8 7 9 6 2 3 7 1 1 5 7 2 3 1 7 4 5 6 3 9 4 9 4 2 3 1 1 2 2 10",
"output": "-1"
},
{
"input": "50\n7 1 6 5 15 3 13 7 1 1 4 2 4 3 2 1 11 9 4 2 3 7 1 1 1 14 3 14 5 2 5 4 1 8 2 2 2 2 1 1 4 1 2 3 6 12 1 1 5 1",
"output": "-1"
},
{
"input": "50\n1 1 4 1 1 1 1 1 1 3 1 1 3 2 1 1 1 1 5 2 1 1 1 1 1 3 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41\n1 2 1 3 4 5 6 7 8 1 9 10 2 1 11 12 13 14 1 2 15 16 17 18 19 3 20 21 22 23 24 25 3 26 27 4 28 29 30 31 32 33 34 35 36 37 38 39 40 41 "
},
{
"input": "100\n2 13 10 4 13 8 22 11 5 3 4 6 19 4 8 8 6 1 16 4 11 17 5 18 7 7 4 5 3 7 2 16 5 6 10 1 6 12 14 6 8 7 9 7 1 2 1 8 5 5 9 21 7 11 6 1 12 10 6 23 10 9 8 4 1 2 3 13 2 14 15 1 1 12 3 9 12 3 13 9 8 1 12 5 2 3 11 7 11 9 3 14 1 2 15 2 10 4 14 20",
"output": "10\n1 1 1 1 2 1 1 1 1 1 2 1 1 3 2 3 2 1 1 4 2 1 2 1 1 2 5 3 2 3 2 2 4 3 2 2 4 1 1 5 4 4 1 5 3 3 4 5 5 6 2 1 6 3 6 5 2 3 7 1 4 3 6 6 6 4 3 3 5 2 1 7 8 3 4 4 4 5 4 5 7 9 5 7 6 6 4 7 5 6 7 3 10 7 2 8 5 7 4 1 "
},
{
"input": "100\n9 6 3 28 10 2 2 11 2 1 25 3 13 5 14 13 4 14 2 16 12 27 8 1 7 9 8 19 33 23 4 1 15 6 7 12 2 8 30 4 1 31 6 1 15 5 18 3 2 24 7 3 1 20 10 8 26 22 3 3 9 6 1 10 1 5 1 3 7 6 11 10 1 16 19 5 9 4 4 4 2 18 12 21 11 5 2 32 17 29 2 4 8 1 7 5 3 2 17 1",
"output": "12\n1 1 1 1 1 1 2 1 3 1 1 2 1 1 1 2 1 2 4 1 1 1 1 2 1 2 2 1 1 1 2 3 1 2 2 2 5 3 1 3 4 1 3 5 2 2 1 3 6 1 3 4 6 1 2 4 1 1 5 6 3 4 7 3 8 3 9 7 4 5 2 4 10 2 2 4 4 4 5 6 7 2 3 1 3 5 8 1 1 1 9 7 5 11 5 6 8 10 2 12 "
},
{
"input": "100\n12 18 1 1 14 23 1 1 22 5 7 9 7 1 1 1 3 8 4 2 1 6 9 1 3 2 11 1 11 2 3 2 1 4 2 7 1 16 3 4 2 13 3 1 5 11 2 10 20 24 3 21 5 2 6 2 1 10 10 5 17 1 1 4 19 8 5 5 3 9 4 2 7 8 10 4 9 1 3 3 9 7 6 4 4 3 6 8 12 1 3 6 2 1 8 4 1 15 2 5",
"output": "20\n1 1 1 2 1 1 3 4 1 1 1 1 2 5 6 7 1 1 1 1 8 1 2 9 2 2 1 10 2 3 3 4 11 2 5 3 12 1 4 3 6 1 5 13 2 3 7 1 1 1 6 1 3 8 2 9 14 2 3 4 1 15 16 4 1 2 5 6 7 3 5 10 4 3 4 6 4 17 8 9 5 5 3 7 8 10 4 4 2 18 11 5 11 19 5 9 20 1 12 7 "
},
{
"input": "100\n10 1 13 1 5 2 5 5 9 10 3 8 4 1 3 5 6 4 1 4 9 8 1 1 1 1 8 2 3 1 1 2 5 1 1 12 6 4 5 3 1 3 18 10 1 2 3 2 6 2 3 15 1 3 5 3 9 7 1 6 11 7 7 8 6 17 11 7 6 1 4 4 1 1 3 1 2 6 7 14 4 4 5 1 11 1 4 2 8 4 2 7 16 12 1 1 2 2 1 2",
"output": "25\n1 1 1 2 1 1 2 3 1 2 1 1 1 3 2 4 1 2 4 3 2 2 5 6 7 8 3 2 3 9 10 3 5 11 12 1 2 4 6 4 13 5 1 3 14 4 6 5 3 6 7 1 15 8 7 9 3 1 16 4 1 2 3 4 5 1 2 4 6 17 5 6 18 19 10 20 7 7 5 1 7 8 8 21 3 22 9 8 5 10 9 6 1 2 23 24 10 11 25 12 "
}
] | 1,641,551,795 | 2,147,483,647 | Python 3 | OK | TESTS | 60 | 233 | 7,372,800 | n= int(input())
a = list(map(int,input().split()))
a.insert(0,0)
k = [0]*(100001)
a1=[0]*(n+1)
maxK=1
maxA=a[1]
for i in range(1,n+1):
k[a[i]]+=1
if k[a[i]]>maxK: maxK=k[a[i]]
if a[i]>maxA: maxA=a[i]
a1[i]=k[a[i]]
f=1
for i in range(1,maxA):
if k[i]<k[i+1]:
f=0
break
if f:
print(maxK)
print(*a1[1:])
else:
print(-1)
# Fri Jan 07 2022 10:36:34 GMT+0000 (Coordinated Universal Time)
| Title: Permutations
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
A permutation is a sequence of integers from 1 to *n* of length *n* containing each number exactly once. For example, (1), (4,<=3,<=5,<=1,<=2), (3,<=2,<=1) are permutations, and (1,<=1), (4,<=3,<=1), (2,<=3,<=4) are not.
There are many tasks on permutations. Today you are going to solve one of them. Let’s imagine that somebody took several permutations (perhaps, with a different number of elements), wrote them down consecutively as one array and then shuffled the resulting array. The task is to restore the initial permutations if it is possible.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The next line contains the mixed array of *n* integers, divided with a single space. The numbers in the array are from 1 to 105.
Output Specification:
If this array can be split into several permutations so that every element of the array belongs to exactly one permutation, print in the first line the number of permutations. The second line should contain *n* numbers, corresponding to the elements of the given array. If the *i*-th element belongs to the first permutation, the *i*-th number should be 1, if it belongs to the second one, then its number should be 2 and so on. The order of the permutations’ numbering is free.
If several solutions are possible, print any one of them. If there’s no solution, print in the first line <=-<=1.
Demo Input:
['9\n1 2 3 1 2 1 4 2 5\n', '4\n4 3 2 1\n', '4\n1 2 2 3\n']
Demo Output:
['3\n3 1 2 1 2 2 2 3 2\n', '1\n1 1 1 1 ', '-1\n']
Note:
In the first sample test the array is split into three permutations: (2, 1), (3, 2, 1, 4, 5), (1, 2). The first permutation is formed by the second and the fourth elements of the array, the second one — by the third, the fifth, the sixth, the seventh and the ninth elements, the third one — by the first and the eigth elements. Clearly, there are other splitting variants possible. | ```python
n= int(input())
a = list(map(int,input().split()))
a.insert(0,0)
k = [0]*(100001)
a1=[0]*(n+1)
maxK=1
maxA=a[1]
for i in range(1,n+1):
k[a[i]]+=1
if k[a[i]]>maxK: maxK=k[a[i]]
if a[i]>maxA: maxA=a[i]
a1[i]=k[a[i]]
f=1
for i in range(1,maxA):
if k[i]<k[i+1]:
f=0
break
if f:
print(maxK)
print(*a1[1:])
else:
print(-1)
# Fri Jan 07 2022 10:36:34 GMT+0000 (Coordinated Universal Time)
``` | 3.869767 |
127 | A | Wasted Time | PROGRAMMING | 900 | [
"geometry"
] | null | null | Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers. | The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters. | Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6. | [
"2 1\n0 0\n10 0\n",
"5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n",
"6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n"
] | [
"0.200000000",
"6.032163204",
"3.000000000"
] | none | 500 | [
{
"input": "2 1\n0 0\n10 0",
"output": "0.200000000"
},
{
"input": "5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0",
"output": "6.032163204"
},
{
"input": "6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0",
"output": "3.000000000"
},
{
"input": "10 95\n-20 -5\n2 -8\n14 13\n10 3\n17 11\n13 -12\n-6 11\n14 -15\n-13 14\n19 8",
"output": "429.309294877"
},
{
"input": "30 1000\n4 -13\n14 13\n-14 -16\n-9 18\n17 11\n2 -8\n2 15\n8 -1\n-9 13\n8 -12\n-2 20\n11 -12\n19 8\n9 -15\n-20 -5\n-18 20\n-13 14\n-12 -17\n-4 3\n13 -12\n11 -10\n18 7\n-6 11\n10 13\n10 3\n6 -14\n-1 10\n14 -15\n2 11\n-8 10",
"output": "13629.282573522"
},
{
"input": "2 1\n-20 -10\n-10 -6",
"output": "0.215406592"
},
{
"input": "2 13\n13 -10\n-3 -2",
"output": "4.651021393"
},
{
"input": "2 21\n13 8\n14 10",
"output": "0.939148551"
},
{
"input": "2 75\n-3 12\n1 12",
"output": "6.000000000"
},
{
"input": "2 466\n10 16\n-6 -3",
"output": "231.503997374"
},
{
"input": "2 999\n6 16\n-17 -14",
"output": "755.286284531"
},
{
"input": "2 1000\n-17 -14\n-14 -8",
"output": "134.164078650"
},
{
"input": "3 384\n-4 -19\n-17 -2\n3 4",
"output": "324.722285390"
},
{
"input": "5 566\n-11 8\n2 -7\n7 0\n-7 -9\n-7 5",
"output": "668.956254495"
},
{
"input": "7 495\n-10 -13\n-9 -5\n4 9\n8 13\n-4 2\n2 10\n-18 15",
"output": "789.212495576"
},
{
"input": "10 958\n7 13\n20 19\n12 -7\n10 -10\n-13 -15\n-10 -7\n20 -5\n-11 19\n-7 3\n-4 18",
"output": "3415.618464093"
},
{
"input": "13 445\n-15 16\n-8 -14\n8 7\n4 15\n8 -13\n15 -11\n-12 -4\n2 -13\n-5 0\n-20 -14\n-8 -7\n-10 -18\n18 -5",
"output": "2113.552527680"
},
{
"input": "18 388\n11 -8\n13 10\n18 -17\n-15 3\n-13 -15\n20 -7\n1 -10\n-13 -12\n-12 -15\n-17 -8\n1 -2\n3 -20\n-8 -9\n15 -13\n-19 -6\n17 3\n-17 2\n6 6",
"output": "2999.497312668"
},
{
"input": "25 258\n-5 -3\n-18 -14\n12 3\n6 11\n4 2\n-19 -3\n19 -7\n-15 19\n-19 -12\n-11 -10\n-5 17\n10 15\n-4 1\n-3 -20\n6 16\n18 -19\n11 -19\n-17 10\n-17 17\n-2 -17\n-3 -9\n18 13\n14 8\n-2 -5\n-11 4",
"output": "2797.756635934"
},
{
"input": "29 848\n11 -10\n-19 1\n18 18\n19 -19\n0 -5\n16 10\n-20 -14\n7 15\n6 8\n-15 -16\n9 3\n16 -20\n-12 12\n18 -1\n-11 14\n18 10\n11 -20\n-20 -16\n-1 11\n13 10\n-6 13\n-7 -10\n-11 -10\n-10 3\n15 -13\n-4 11\n-13 -11\n-11 -17\n11 -5",
"output": "12766.080247922"
},
{
"input": "36 3\n-11 20\n-11 13\n-17 9\n15 9\n-6 9\n-1 11\n12 -11\n16 -10\n-20 7\n-18 6\n-15 -2\n20 -20\n16 4\n-20 -8\n-12 -15\n-13 -6\n-9 -4\n0 -10\n8 -1\n1 4\n5 8\n8 -15\n16 -12\n19 1\n0 -4\n13 -4\n17 -13\n-7 11\n14 9\n-14 -9\n5 -8\n11 -8\n-17 -5\n1 -3\n-16 -17\n2 -3",
"output": "36.467924851"
},
{
"input": "48 447\n14 9\n9 -17\n-17 11\n-14 14\n19 -8\n-14 -17\n-7 10\n-6 -11\n-9 -19\n19 10\n-4 2\n-5 16\n20 9\n-10 20\n-7 -17\n14 -16\n-2 -10\n-18 -17\n14 12\n-6 -19\n5 -18\n-3 2\n-3 10\n-5 5\n13 -12\n10 -18\n10 -12\n-2 4\n7 -15\n-5 -5\n11 14\n11 10\n-6 -9\n13 -4\n13 9\n6 12\n-13 17\n-9 -12\n14 -19\n10 12\n-15 8\n-1 -11\n19 8\n11 20\n-9 -3\n16 1\n-14 19\n8 -4",
"output": "9495.010556306"
},
{
"input": "50 284\n-17 -13\n7 12\n-13 0\n13 1\n14 6\n14 -9\n-5 -1\n0 -10\n12 -3\n-14 6\n-8 10\n-16 17\n0 -1\n4 -9\n2 6\n1 8\n-8 -14\n3 9\n1 -15\n-4 -19\n-7 -20\n18 10\n3 -11\n10 16\n2 -6\n-9 19\n-3 -1\n20 9\n-12 -5\n-10 -2\n16 -7\n-16 -18\n-2 17\n2 8\n7 -15\n4 1\n6 -17\n19 9\n-10 -20\n5 2\n10 -2\n3 7\n20 0\n8 -14\n-16 -1\n-20 7\n20 -19\n17 18\n-11 -18\n-16 14",
"output": "6087.366930474"
},
{
"input": "57 373\n18 3\n-4 -1\n18 5\n-7 -15\n-6 -10\n-19 1\n20 15\n15 4\n-1 -2\n13 -14\n0 12\n10 3\n-16 -17\n-14 -9\n-11 -10\n17 19\n-2 6\n-12 -15\n10 20\n16 7\n9 -1\n4 13\n8 -2\n-1 -16\n-3 8\n14 11\n-12 3\n-5 -6\n3 4\n5 7\n-9 9\n11 4\n-19 10\n-7 4\n-20 -12\n10 16\n13 11\n13 -11\n7 -1\n17 18\n-19 7\n14 13\n5 -1\n-7 6\n-1 -6\n6 20\n-16 2\n4 17\n16 -11\n-4 -20\n19 -18\n17 16\n-14 -8\n3 2\n-6 -16\n10 -10\n-13 -11",
"output": "8929.162822862"
},
{
"input": "60 662\n15 17\n-2 -19\n-4 -17\n10 0\n15 10\n-8 -14\n14 9\n-15 20\n6 5\n-9 0\n-13 20\n13 -2\n10 9\n7 5\n4 18\n-10 1\n6 -15\n15 -16\n6 13\n4 -6\n2 5\n18 19\n8 3\n-7 14\n-12 -20\n14 19\n-15 0\n-2 -12\n9 18\n14 4\n2 -20\n3 0\n20 9\n-5 11\n-11 1\n2 -19\n-14 -4\n18 6\n16 16\n15 3\n-1 -5\n9 20\n12 -8\n-1 10\n-4 -9\n3 6\n3 -12\n14 -10\n-8 10\n-18 6\n14 -2\n-14 -12\n-10 -7\n10 -6\n14 1\n6 14\n15 19\n4 14\n3 -14\n-9 -13",
"output": "16314.207721932"
},
{
"input": "61 764\n-9 15\n11 -8\n-6 -7\n-13 -19\n16 -16\n-5 -1\n20 -19\n-14 -1\n-11 4\n7 -2\n-3 2\n-14 -17\n15 18\n20 15\n-13 -2\n15 8\n3 13\n19 -10\n2 -6\n15 -3\n-12 11\n4 -16\n-14 20\n0 2\n11 -7\n-6 -11\n16 7\n8 -3\n16 -10\n-3 9\n9 5\n4 -1\n-17 9\n14 -4\n8 6\n-19 12\n10 -17\n-5 7\n7 -3\n5 3\n6 -14\n9 9\n-16 -19\n11 -16\n-17 15\n8 5\n16 -19\n-7 10\n14 -15\n15 19\n-20 -16\n6 -2\n-4 6\n7 -15\n1 -8\n20 -17\n3 7\n10 12\n10 -11\n-19 10\n0 -11",
"output": "22153.369189802"
}
] | 1,668,766,875 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | import math
inputs = list(map(int,input().split()))
coordinate_numbers = inputs[0]
signature_number = inputs[1]
coordinates = []
total_length = 0
for _ in range(coordinate_numbers):
coordinate = list(map(int,input().split()))
coordinates.append(coordinate)
for index, value in enumerate(coordinates):
if index < len(coordinates) - 1:
length = math.sqrt(pow((coordinates[index][0] - coordinates[index+1][0]), 2) + pow((coordinates[index][1] - coordinates[index+1][1]), 2))
print(length)
total_length = total_length + length
print((total_length/50) *signature_number) | Title: Wasted Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Scrooge, a very busy man, decided to count the time he wastes on all sorts of useless stuff to evaluate the lost profit. He has already counted the time he wastes sleeping and eating. And now Mr. Scrooge wants to count the time he has wasted signing papers.
Mr. Scrooge's signature can be represented as a polyline *A*1*A*2... *A**n*. Scrooge signs like that: first it places a pen at the point *A*1, then draws a segment from point *A*1 to point *A*2, then he draws a segment from point *A*2 to point *A*3 and so on to point *A**n*, where he stops signing and takes the pen off the paper. At that the resulting line can intersect with itself and partially repeat itself but Scrooge pays no attention to it and never changes his signing style. As Scrooge makes the signature, he never takes the pen off the paper and his writing speed is constant — 50 millimeters per second.
Scrooge signed exactly *k* papers throughout his life and all those signatures look the same.
Find the total time Scrooge wasted signing the papers.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000). Each of the following *n* lines contains the coordinates of the polyline's endpoints. The *i*-th one contains coordinates of the point *A**i* — integers *x**i* and *y**i*, separated by a space.
All points *A**i* are different. The absolute value of all coordinates does not exceed 20. The coordinates are measured in millimeters.
Output Specification:
Print one real number — the total time Scrooges wastes on signing the papers in seconds. The absolute or relative error should not exceed 10<=-<=6.
Demo Input:
['2 1\n0 0\n10 0\n', '5 10\n3 1\n-5 6\n-2 -1\n3 2\n10 0\n', '6 10\n5 0\n4 0\n6 0\n3 0\n7 0\n2 0\n']
Demo Output:
['0.200000000', '6.032163204', '3.000000000']
Note:
none | ```python
import math
inputs = list(map(int,input().split()))
coordinate_numbers = inputs[0]
signature_number = inputs[1]
coordinates = []
total_length = 0
for _ in range(coordinate_numbers):
coordinate = list(map(int,input().split()))
coordinates.append(coordinate)
for index, value in enumerate(coordinates):
if index < len(coordinates) - 1:
length = math.sqrt(pow((coordinates[index][0] - coordinates[index+1][0]), 2) + pow((coordinates[index][1] - coordinates[index+1][1]), 2))
print(length)
total_length = total_length + length
print((total_length/50) *signature_number)
``` | 0 |
|
572 | A | Arrays | PROGRAMMING | 900 | [
"sortings"
] | null | null | You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array. | The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*. | Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes). | [
"3 3\n2 1\n1 2 3\n3 4 5\n",
"3 3\n3 3\n1 2 3\n3 4 5\n",
"5 2\n3 1\n1 1 1 1 1\n2 2\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 500 | [
{
"input": "3 3\n2 1\n1 2 3\n3 4 5",
"output": "YES"
},
{
"input": "3 3\n3 3\n1 2 3\n3 4 5",
"output": "NO"
},
{
"input": "5 2\n3 1\n1 1 1 1 1\n2 2",
"output": "YES"
},
{
"input": "3 5\n1 1\n5 5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n1 1\n1\n1",
"output": "NO"
},
{
"input": "3 3\n1 1\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n1 2\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n2 2\n1 2 3\n1 2 3",
"output": "NO"
},
{
"input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49",
"output": "YES"
},
{
"input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100",
"output": "YES"
},
{
"input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99",
"output": "YES"
},
{
"input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81",
"output": "YES"
},
{
"input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10",
"output": "NO"
},
{
"input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "1 1\n1 1\n-1000000000\n30",
"output": "YES"
},
{
"input": "3 3\n1 3\n1 3 3\n3 3 3",
"output": "YES"
},
{
"input": "3 3\n1 1\n3 3 3\n2 2 2",
"output": "NO"
},
{
"input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7",
"output": "NO"
},
{
"input": "3 4\n2 2\n5 6 7\n1 2 3 4",
"output": "NO"
},
{
"input": "3 3\n3 3\n1 2 3\n4 5 6",
"output": "YES"
},
{
"input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9",
"output": "YES"
}
] | 1,631,627,683 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 6,963,200 | def solution(k, m, list_a, list_b):
if list_a[k-1] < list_b[m-1]:
print('YES')
return
print('NO')
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def main():
n_a_b_list = inlt()
k_m = inlt()
k = k_m[0]
m = k_m[1]
list_a = intl()
list_b = intl()
solution(k, m, list_a, list_b)
main()
| Title: Arrays
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
Input Specification:
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Output Specification:
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
Demo Input:
['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
def solution(k, m, list_a, list_b):
if list_a[k-1] < list_b[m-1]:
print('YES')
return
print('NO')
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def main():
n_a_b_list = inlt()
k_m = inlt()
k = k_m[0]
m = k_m[1]
list_a = intl()
list_b = intl()
solution(k, m, list_a, list_b)
main()
``` | -1 |
|
266 | A | Stones on the Table | PROGRAMMING | 800 | [
"implementation"
] | null | null | There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them. | The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue. | Print a single integer — the answer to the problem. | [
"3\nRRG\n",
"5\nRRRRR\n",
"4\nBRBG\n"
] | [
"1\n",
"4\n",
"0\n"
] | none | 500 | [
{
"input": "3\nRRG",
"output": "1"
},
{
"input": "5\nRRRRR",
"output": "4"
},
{
"input": "4\nBRBG",
"output": "0"
},
{
"input": "1\nB",
"output": "0"
},
{
"input": "2\nBG",
"output": "0"
},
{
"input": "3\nBGB",
"output": "0"
},
{
"input": "4\nRBBR",
"output": "1"
},
{
"input": "5\nRGGBG",
"output": "1"
},
{
"input": "10\nGGBRBRGGRB",
"output": "2"
},
{
"input": "50\nGRBGGRBRGRBGGBBBBBGGGBBBBRBRGBRRBRGBBBRBBRRGBGGGRB",
"output": "18"
},
{
"input": "15\nBRRBRGGBBRRRRGR",
"output": "6"
},
{
"input": "20\nRRGBBRBRGRGBBGGRGRRR",
"output": "6"
},
{
"input": "25\nBBGBGRBGGBRRBGRRBGGBBRBRB",
"output": "6"
},
{
"input": "30\nGRGGGBGGRGBGGRGRBGBGBRRRRRRGRB",
"output": "9"
},
{
"input": "35\nGBBGBRGBBGGRBBGBRRGGRRRRRRRBRBBRRGB",
"output": "14"
},
{
"input": "40\nGBBRRGBGGGRGGGRRRRBRBGGBBGGGBGBBBBBRGGGG",
"output": "20"
},
{
"input": "45\nGGGBBRBBRRGRBBGGBGRBRGGBRBRGBRRGBGRRBGRGRBRRG",
"output": "11"
},
{
"input": "50\nRBGGBGGRBGRBBBGBBGRBBBGGGRBBBGBBBGRGGBGGBRBGBGRRGG",
"output": "17"
},
{
"input": "50\nGGGBBRGGGGGRRGGRBGGRGBBRBRRBGRGBBBGBRBGRGBBGRGGBRB",
"output": "16"
},
{
"input": "50\nGBGRGRRBRRRRRGGBBGBRRRBBBRBBBRRGRBBRGBRBGGRGRBBGGG",
"output": "19"
},
{
"input": "10\nGRRBRBRBGR",
"output": "1"
},
{
"input": "10\nBRBGBGRRBR",
"output": "1"
},
{
"input": "20\nGBGBGGRRRRGRBBGRGRGR",
"output": "5"
},
{
"input": "20\nRRGGRBBGBBRBGRRBRRBG",
"output": "6"
},
{
"input": "30\nBGBRGBBBGRGBBRGBGRBBBRGGRRGRRB",
"output": "8"
},
{
"input": "30\nBBBBGGBRBGBBGBGBGBGGGRGRRGGBBB",
"output": "11"
},
{
"input": "40\nGBRRGRBGBRRGBRGGGBRGBGBRGBBRRGRGGBBGBGBB",
"output": "9"
},
{
"input": "40\nBRGRGGRGGRBBRRRBRBBGGGRRGBGBBGRBBRGBRRGG",
"output": "13"
},
{
"input": "50\nRBGBGGRRGGRGGBGBGRRBGGBGBRRBBGBBGBBBGBBRBBRBRBRGRG",
"output": "13"
},
{
"input": "50\nRBRRGBGRRRBGRRBGRRGRBBRBBRRBRGGBRBRRBGGRBGGBRBRGRB",
"output": "12"
},
{
"input": "2\nBB",
"output": "1"
},
{
"input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "49"
},
{
"input": "50\nRRRRRRRRGRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "47"
},
{
"input": "50\nRRRRRRRRRRRRGGRRRRRRRRRBRRRRRRRRRRRRRRBBRRRRRRRRRR",
"output": "43"
}
] | 1,698,901,050 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 92 | 0 | n = int(input())
str = input()
lst = list(str)
lst1 = lst.copy()
count = 0
for i in range (0,len(lst1)-1):
if(lst[i] == lst[i+1]):
count = count+1
print(count) | Title: Stones on the Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3\nRRG\n', '5\nRRRRR\n', '4\nBRBG\n']
Demo Output:
['1\n', '4\n', '0\n']
Note:
none | ```python
n = int(input())
str = input()
lst = list(str)
lst1 = lst.copy()
count = 0
for i in range (0,len(lst1)-1):
if(lst[i] == lst[i+1]):
count = count+1
print(count)
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,639,059,508 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | m,n = map(int, input().split())
int res
def Domino(m,n,res):
if (m % 2 ==0):
res = (m//2) * n
else:
res = ((m//2) * n) + n//2
return res
| Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
m,n = map(int, input().split())
int res
def Domino(m,n,res):
if (m % 2 ==0):
res = (m//2) * n
else:
res = ((m//2) * n) + n//2
return res
``` | -1 |
217 | A | Ice Skating | PROGRAMMING | 1,200 | [
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null | Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates. | The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct. | Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one. | [
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] | [
"1\n",
"0\n"
] | none | 500 | [
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,495,639,935 | 2,147,483,647 | Python 3 | OK | TESTS | 76 | 248 | 5,324,800 | n=int(input())
M=[[0 for i in range(1001)] for i in range(1001)]
ans=n-1
T=[]
for i in range(n) :
a,b=map(int,input().split())
M[a][b]=1
T.append([a,b])
for i in range(n) :
r=T[i]
if M[r[0]][r[1]]!=-1 :
M[r[0]][r[1]]=-1
l=[[r[0],r[1]]]
while len(l)>0 :
g=l[0]
del(l[0])
for j in range(n) :
if T[j][0]==g[0] and M[T[j][0]][T[j][1]]!=-1 or T[j][1]==g[1] and M[T[j][0]][T[j][1]]!=-1 :
l.append([T[j][0],T[j][1]])
M[T[j][0]][T[j][1]]=-1
ans=ans-1
print(ans)
| Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
n=int(input())
M=[[0 for i in range(1001)] for i in range(1001)]
ans=n-1
T=[]
for i in range(n) :
a,b=map(int,input().split())
M[a][b]=1
T.append([a,b])
for i in range(n) :
r=T[i]
if M[r[0]][r[1]]!=-1 :
M[r[0]][r[1]]=-1
l=[[r[0],r[1]]]
while len(l)>0 :
g=l[0]
del(l[0])
for j in range(n) :
if T[j][0]==g[0] and M[T[j][0]][T[j][1]]!=-1 or T[j][1]==g[1] and M[T[j][0]][T[j][1]]!=-1 :
l.append([T[j][0],T[j][1]])
M[T[j][0]][T[j][1]]=-1
ans=ans-1
print(ans)
``` | 3 |
|
49 | A | Sleuth | PROGRAMMING | 800 | [
"implementation"
] | A. Sleuth | 2 | 256 | Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z | The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter. | Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters. | [
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] | [
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] | none | 500 | [
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,632,148,406 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 248 | 22,425,600 | s=input()
a=s.rstrip(" ?")
if a[-1].lower in "aeiou":
print("YES")
else:
print("NO") | Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none | ```python
s=input()
a=s.rstrip(" ?")
if a[-1].lower in "aeiou":
print("YES")
else:
print("NO")
``` | -1 |
40 | A | Find Color | PROGRAMMING | 1,300 | [
"constructive algorithms",
"geometry",
"implementation",
"math"
] | A. Find Color | 2 | 256 | Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black. | The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000. | Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black. | [
"-2 1\n",
"2 1\n",
"4 3\n"
] | [
"white\n",
"black\n",
"black\n"
] | none | 500 | [
{
"input": "-2 1",
"output": "white"
},
{
"input": "2 1",
"output": "black"
},
{
"input": "4 3",
"output": "black"
},
{
"input": "3 3",
"output": "black"
},
{
"input": "4 4",
"output": "white"
},
{
"input": "-4 4",
"output": "black"
},
{
"input": "4 -4",
"output": "black"
},
{
"input": "-4 -4",
"output": "white"
},
{
"input": "0 0",
"output": "black"
},
{
"input": "0 1",
"output": "black"
},
{
"input": "0 2",
"output": "black"
},
{
"input": "0 1000",
"output": "black"
},
{
"input": "1000 0",
"output": "black"
},
{
"input": "-1000 0",
"output": "black"
},
{
"input": "0 -1000",
"output": "black"
},
{
"input": "1000 -1000",
"output": "white"
},
{
"input": "12 5",
"output": "black"
},
{
"input": "12 -5",
"output": "black"
},
{
"input": "-12 -35",
"output": "black"
},
{
"input": "20 -21",
"output": "black"
},
{
"input": "-677 492",
"output": "white"
},
{
"input": "-673 -270",
"output": "white"
},
{
"input": "-668 970",
"output": "black"
},
{
"input": "-220 208",
"output": "white"
},
{
"input": "-215 -996",
"output": "black"
},
{
"input": "-211 243",
"output": "black"
},
{
"input": "-206 -518",
"output": "white"
},
{
"input": "-201 278",
"output": "black"
},
{
"input": "-196 -484",
"output": "black"
},
{
"input": "902 479",
"output": "white"
},
{
"input": "-441 572",
"output": "white"
},
{
"input": "217 221",
"output": "white"
},
{
"input": "875 -129",
"output": "white"
},
{
"input": "-469 -36",
"output": "black"
},
{
"input": "189 -387",
"output": "white"
},
{
"input": "847 -294",
"output": "white"
},
{
"input": "-496 -644",
"output": "black"
},
{
"input": "-281 -552",
"output": "white"
},
{
"input": "377 -902",
"output": "black"
},
{
"input": "165 -738",
"output": "white"
},
{
"input": "61 -175",
"output": "black"
},
{
"input": "-42 389",
"output": "black"
},
{
"input": "-589 952",
"output": "black"
},
{
"input": "-693 -929",
"output": "white"
},
{
"input": "-796 -365",
"output": "white"
},
{
"input": "658 198",
"output": "white"
},
{
"input": "555 319",
"output": "black"
},
{
"input": "8 882",
"output": "black"
},
{
"input": "-96 -556",
"output": "black"
},
{
"input": "-129 489",
"output": "black"
},
{
"input": "207 -224",
"output": "black"
},
{
"input": "64 0",
"output": "black"
},
{
"input": "17 144",
"output": "black"
},
{
"input": "60 -448",
"output": "black"
},
{
"input": "-399 -40",
"output": "black"
},
{
"input": "128 -504",
"output": "black"
},
{
"input": "0 72",
"output": "black"
},
{
"input": "168 -26",
"output": "black"
},
{
"input": "72 -154",
"output": "black"
},
{
"input": "117 -44",
"output": "black"
},
{
"input": "-72 -646",
"output": "black"
},
{
"input": "253 -204",
"output": "black"
},
{
"input": "-40 198",
"output": "black"
},
{
"input": "-216 -90",
"output": "black"
},
{
"input": "15 -8",
"output": "black"
},
{
"input": "-180 -432",
"output": "black"
},
{
"input": "280 342",
"output": "black"
},
{
"input": "132 224",
"output": "black"
},
{
"input": "-192 -256",
"output": "black"
},
{
"input": "351 -280",
"output": "black"
}
] | 1,563,073,734 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include<iostream>
#include<cmath>
#include<cstdio>
using namespace std;
int x,y;
double n;
main(){
scanf("%d%d",&x,&y);
n=sqrt(x*x+y*y);
if(ceil(n)>n)
if(x*y>0==(((int)(ceil(n)))&1)) printf("black");
else printf("white");
else printf("black");
return 0;
} | Title: Find Color
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black.
Input Specification:
The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000.
Output Specification:
Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black.
Demo Input:
['-2 1\n', '2 1\n', '4 3\n']
Demo Output:
['white\n', 'black\n', 'black\n']
Note:
none | ```python
#include<iostream>
#include<cmath>
#include<cstdio>
using namespace std;
int x,y;
double n;
main(){
scanf("%d%d",&x,&y);
n=sqrt(x*x+y*y);
if(ceil(n)>n)
if(x*y>0==(((int)(ceil(n)))&1)) printf("black");
else printf("white");
else printf("black");
return 0;
}
``` | -1 |
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,673,189,863 | 2,147,483,647 | Python 3 | OK | TESTS | 20 | 46 | 0 | """
### Task 4A - Watermelon ###
weight = int(input())
if weight %2 ==0 and 4<= weight<=100:
print('YES')
else:
print('NO')
"""
### Task 71A Way too long words ###
i_words = int(input())
for i in range(i_words):
word = input()
if len(word)>10:
print(f"{word[0]}{len(word[1:len(word)-1])}{word[len(word)-1]}")
else:
print(word) | Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
"""
### Task 4A - Watermelon ###
weight = int(input())
if weight %2 ==0 and 4<= weight<=100:
print('YES')
else:
print('NO')
"""
### Task 71A Way too long words ###
i_words = int(input())
for i in range(i_words):
word = input()
if len(word)>10:
print(f"{word[0]}{len(word[1:len(word)-1])}{word[len(word)-1]}")
else:
print(word)
``` | 3.977 |
932 | A | Palindromic Supersequence | PROGRAMMING | 800 | [
"constructive algorithms"
] | null | null | You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. | First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*. | Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them. | [
"aba\n",
"ab\n"
] | [
"aba",
"aabaa"
] | In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome. | 500 | [
{
"input": "aba",
"output": "abaaba"
},
{
"input": "ab",
"output": "abba"
},
{
"input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa",
"output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..."
},
{
"input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco",
"output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..."
},
{
"input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar",
"output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..."
},
{
"input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg",
"output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..."
},
{
"input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm",
"output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..."
},
{
"input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj",
"output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..."
},
{
"input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd",
"output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..."
},
{
"input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig",
"output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..."
},
{
"input": "abcab",
"output": "abcabbacba"
},
{
"input": "baaaaaaa",
"output": "baaaaaaaaaaaaaab"
},
{
"input": "baaaaaa",
"output": "baaaaaaaaaaaab"
},
{
"input": "baaaaaaaaa",
"output": "baaaaaaaaaaaaaaaaaab"
},
{
"input": "baaaaaaaa",
"output": "baaaaaaaaaaaaaaaab"
}
] | 1,622,892,071 | 2,147,483,647 | Python 3 | OK | TESTS | 48 | 170 | 0 | class SuperPolindrom:
def __init__(self,str):
self.__str=str
def IsPolindrom(self):
return self.__str==self.__str[::-1]
def __str__(self):
return self.__str if self.IsPolindrom() else "{0}{1}{2}".format(self.__str,self.__str[-2:0:-1],self.__str[0])
print(SuperPolindrom(input()))
| Title: Palindromic Supersequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
Input Specification:
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output Specification:
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
Demo Input:
['aba\n', 'ab\n']
Demo Output:
['aba', 'aabaa']
Note:
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome. | ```python
class SuperPolindrom:
def __init__(self,str):
self.__str=str
def IsPolindrom(self):
return self.__str==self.__str[::-1]
def __str__(self):
return self.__str if self.IsPolindrom() else "{0}{1}{2}".format(self.__str,self.__str[-2:0:-1],self.__str[0])
print(SuperPolindrom(input()))
``` | 3 |
|
445 | B | DZY Loves Chemistry | PROGRAMMING | 1,400 | [
"dfs and similar",
"dsu",
"greedy"
] | null | null | DZY loves chemistry, and he enjoys mixing chemicals.
DZY has *n* chemicals, and *m* pairs of them will react. He wants to pour these chemicals into a test tube, and he needs to pour them in one by one, in any order.
Let's consider the danger of a test tube. Danger of an empty test tube is 1. And every time when DZY pours a chemical, if there are already one or more chemicals in the test tube that can react with it, the danger of the test tube will be multiplied by 2. Otherwise the danger remains as it is.
Find the maximum possible danger after pouring all the chemicals one by one in optimal order. | The first line contains two space-separated integers *n* and *m* .
Each of the next *m* lines contains two space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=<<=*y**i*<=≤<=*n*). These integers mean that the chemical *x**i* will react with the chemical *y**i*. Each pair of chemicals will appear at most once in the input.
Consider all the chemicals numbered from 1 to *n* in some order. | Print a single integer — the maximum possible danger. | [
"1 0\n",
"2 1\n1 2\n",
"3 2\n1 2\n2 3\n"
] | [
"1\n",
"2\n",
"4\n"
] | In the first sample, there's only one way to pour, and the danger won't increase.
In the second sample, no matter we pour the 1st chemical first, or pour the 2nd chemical first, the answer is always 2.
In the third sample, there are four ways to achieve the maximum possible danger: 2-1-3, 2-3-1, 1-2-3 and 3-2-1 (that is the numbers of the chemicals in order of pouring). | 1,000 | [
{
"input": "1 0",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
},
{
"input": "3 2\n1 2\n2 3",
"output": "4"
},
{
"input": "10 10\n1 8\n4 10\n4 6\n5 10\n2 3\n1 7\n3 4\n3 6\n6 9\n3 7",
"output": "512"
},
{
"input": "20 20\n6 8\n13 20\n7 13\n6 17\n5 15\n1 12\n2 15\n5 17\n5 14\n6 14\n12 20\n7 20\n1 6\n1 7\n2 19\n14 17\n1 10\n11 15\n9 18\n2 12",
"output": "32768"
},
{
"input": "30 30\n7 28\n16 26\n14 24\n16 18\n20 29\n4 28\n19 21\n8 26\n1 25\n14 22\n13 23\n4 15\n15 16\n2 19\n29 30\n12 20\n3 4\n3 26\n3 11\n22 27\n5 16\n2 24\n2 18\n7 16\n17 21\n17 25\n8 15\n23 27\n12 21\n5 30",
"output": "67108864"
},
{
"input": "40 40\n28 33\n15 21\n12 29\n14 31\n2 26\n3 12\n25 34\n6 30\n6 25\n5 28\n9 17\n23 29\n30 36\n3 21\n35 37\n7 25\n29 39\n15 19\n12 35\n24 34\n15 25\n19 33\n26 31\n7 29\n1 40\n11 27\n6 9\n6 27\n36 39\n10 14\n6 16\n23 25\n2 38\n3 24\n30 31\n29 30\n4 12\n11 13\n14 40\n22 39",
"output": "34359738368"
},
{
"input": "50 50\n16 21\n23 47\n23 30\n2 12\n23 41\n3 16\n14 20\n4 49\n2 47\n19 29\n13 42\n5 8\n24 38\n13 32\n34 37\n38 46\n3 20\n27 50\n7 42\n33 45\n2 48\n41 47\n9 48\n15 26\n27 37\n32 34\n17 24\n1 39\n27 30\n10 33\n38 47\n32 33\n14 39\n35 50\n2 19\n3 12\n27 34\n18 25\n12 23\n31 44\n5 35\n28 45\n38 39\n13 44\n34 38\n16 46\n5 15\n26 30\n47 49\n2 10",
"output": "4398046511104"
},
{
"input": "50 0",
"output": "1"
},
{
"input": "50 7\n16 32\n31 34\n4 16\n4 39\n1 50\n43 49\n1 33",
"output": "128"
},
{
"input": "7 20\n2 3\n3 6\n1 6\n1 2\n3 5\n1 7\n4 5\n4 7\n1 3\n2 6\n2 7\n4 6\n3 4\n1 4\n3 7\n1 5\n2 5\n5 6\n5 7\n2 4",
"output": "64"
},
{
"input": "5 4\n1 2\n2 3\n3 4\n4 5",
"output": "16"
},
{
"input": "10 7\n1 2\n2 3\n1 5\n2 7\n7 8\n1 9\n9 10",
"output": "128"
},
{
"input": "20 15\n1 3\n3 4\n3 5\n4 6\n1 7\n1 8\n1 9\n7 11\n8 12\n5 13\n3 16\n1 17\n3 18\n1 19\n17 20",
"output": "32768"
},
{
"input": "30 24\n2 3\n3 4\n1 5\n4 6\n6 7\n1 8\n1 9\n4 10\n9 11\n5 12\n6 13\n10 14\n14 15\n12 16\n14 17\n2 18\n8 19\n3 20\n10 21\n11 24\n3 25\n1 26\n7 27\n4 29",
"output": "16777216"
},
{
"input": "40 28\n1 2\n2 4\n3 5\n1 7\n1 8\n7 9\n6 10\n7 11\n2 12\n9 13\n11 15\n12 16\n1 18\n10 19\n7 21\n7 23\n20 25\n24 27\n14 28\n9 29\n23 30\n27 31\n11 34\n21 35\n32 36\n23 38\n7 39\n20 40",
"output": "268435456"
},
{
"input": "50 41\n1 2\n1 3\n2 4\n1 5\n2 7\n4 8\n7 9\n2 11\n10 13\n11 14\n12 15\n14 16\n4 19\n7 20\n14 21\n8 23\n16 24\n16 25\n16 26\n19 27\n2 28\n3 29\n21 30\n12 31\n20 32\n23 33\n30 34\n6 35\n34 36\n34 37\n33 38\n34 40\n30 41\n3 42\n39 43\n5 44\n8 45\n40 46\n20 47\n31 49\n34 50",
"output": "2199023255552"
},
{
"input": "50 39\n1 2\n1 4\n5 6\n4 7\n5 8\n7 9\n9 10\n10 11\n2 12\n8 14\n11 15\n11 17\n3 18\n13 19\n17 20\n7 21\n6 22\n22 23\n14 24\n22 25\n23 26\n26 27\n27 28\n15 29\n8 30\n26 31\n32 33\n21 35\n14 36\n30 37\n17 38\n12 40\n11 42\n14 43\n12 44\n1 45\n29 46\n22 47\n47 50",
"output": "549755813888"
},
{
"input": "50 38\n1 2\n2 3\n3 4\n3 5\n4 7\n5 10\n9 11\n9 12\n11 13\n12 14\n6 15\n8 16\n2 18\n15 19\n3 20\n10 21\n4 22\n9 24\n2 25\n23 26\n3 28\n20 29\n14 30\n4 32\n24 33\n20 36\n1 38\n19 39\n39 40\n22 41\n18 42\n19 43\n40 45\n45 46\n9 47\n6 48\n9 49\n25 50",
"output": "274877906944"
},
{
"input": "50 41\n1 3\n1 4\n2 5\n2 7\n1 8\n2 10\n4 11\n5 12\n12 13\n4 14\n10 17\n1 18\n1 21\n5 22\n14 23\n19 24\n13 25\n3 26\n11 27\n6 28\n26 29\n21 30\n17 31\n15 32\n1 33\n12 34\n23 36\n6 37\n15 38\n37 39\n31 40\n15 41\n25 42\n19 43\n20 44\n32 45\n44 46\n31 47\n2 48\n32 49\n27 50",
"output": "2199023255552"
},
{
"input": "50 47\n1 2\n1 3\n1 4\n1 5\n5 6\n2 7\n2 8\n2 9\n2 10\n8 11\n5 12\n11 13\n10 14\n6 15\n9 16\n1 17\n1 18\n8 19\n5 20\n5 21\n11 22\n2 23\n22 24\n24 25\n5 26\n21 27\n27 28\n8 29\n2 30\n4 31\n11 32\n17 33\n22 34\n25 35\n28 36\n28 37\n11 38\n17 39\n19 42\n6 43\n11 44\n29 45\n2 46\n24 47\n7 48\n3 49\n44 50",
"output": "140737488355328"
},
{
"input": "11 20\n3 6\n2 6\n2 9\n4 5\n9 11\n6 8\n5 6\n1 6\n4 11\n9 10\n5 10\n4 6\n3 8\n2 3\n1 7\n1 11\n2 7\n1 3\n3 7\n1 8",
"output": "1024"
},
{
"input": "26 17\n1 2\n2 3\n1 6\n6 7\n7 8\n2 9\n4 10\n3 11\n11 12\n9 13\n6 14\n2 16\n5 18\n6 19\n11 22\n15 24\n6 26",
"output": "131072"
},
{
"input": "48 43\n1 2\n1 3\n3 4\n4 5\n2 6\n5 7\n7 9\n4 10\n6 11\n3 12\n6 13\n3 14\n6 15\n13 16\n4 17\n12 18\n18 19\n1 20\n1 21\n16 22\n9 23\n3 24\n22 25\n2 26\n10 27\n18 28\n13 30\n3 31\n24 33\n29 34\n15 35\n16 36\n23 37\n21 38\n34 39\n37 40\n39 41\n19 42\n15 43\n23 44\n22 45\n14 47\n10 48",
"output": "8796093022208"
},
{
"input": "8 5\n1 2\n1 3\n1 4\n5 6\n7 8",
"output": "32"
},
{
"input": "8 7\n1 2\n2 3\n3 4\n1 4\n5 6\n6 7\n7 8",
"output": "64"
}
] | 1,625,162,866 | 2,147,483,647 | PyPy 3 | OK | TESTS | 32 | 234 | 10,035,200 | import sys
import math
import collections
import heapq
import decimal
input=sys.stdin.readline
n,m=(int(i) for i in input().split())
d={}
for i in range(n):
d[i]=[]
for j in range(m):
x,y=(int(i) for i in input().split())
d[x-1].append(y-1)
d[y-1].append(x-1)
p=1
v=[0]*n
for i in range(n):
if(v[i]==0):
c=0
queue=[i]
v[i]=1
while(queue!=[]):
s=queue.pop(0)
c+=1
for j in d[s]:
if(v[j]==0):
v[j]=1
queue.append(j)
p*=pow(2,c-1)
print(p) | Title: DZY Loves Chemistry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chemistry, and he enjoys mixing chemicals.
DZY has *n* chemicals, and *m* pairs of them will react. He wants to pour these chemicals into a test tube, and he needs to pour them in one by one, in any order.
Let's consider the danger of a test tube. Danger of an empty test tube is 1. And every time when DZY pours a chemical, if there are already one or more chemicals in the test tube that can react with it, the danger of the test tube will be multiplied by 2. Otherwise the danger remains as it is.
Find the maximum possible danger after pouring all the chemicals one by one in optimal order.
Input Specification:
The first line contains two space-separated integers *n* and *m* .
Each of the next *m* lines contains two space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=<<=*y**i*<=≤<=*n*). These integers mean that the chemical *x**i* will react with the chemical *y**i*. Each pair of chemicals will appear at most once in the input.
Consider all the chemicals numbered from 1 to *n* in some order.
Output Specification:
Print a single integer — the maximum possible danger.
Demo Input:
['1 0\n', '2 1\n1 2\n', '3 2\n1 2\n2 3\n']
Demo Output:
['1\n', '2\n', '4\n']
Note:
In the first sample, there's only one way to pour, and the danger won't increase.
In the second sample, no matter we pour the 1st chemical first, or pour the 2nd chemical first, the answer is always 2.
In the third sample, there are four ways to achieve the maximum possible danger: 2-1-3, 2-3-1, 1-2-3 and 3-2-1 (that is the numbers of the chemicals in order of pouring). | ```python
import sys
import math
import collections
import heapq
import decimal
input=sys.stdin.readline
n,m=(int(i) for i in input().split())
d={}
for i in range(n):
d[i]=[]
for j in range(m):
x,y=(int(i) for i in input().split())
d[x-1].append(y-1)
d[y-1].append(x-1)
p=1
v=[0]*n
for i in range(n):
if(v[i]==0):
c=0
queue=[i]
v[i]=1
while(queue!=[]):
s=queue.pop(0)
c+=1
for j in d[s]:
if(v[j]==0):
v[j]=1
queue.append(j)
p*=pow(2,c-1)
print(p)
``` | 3 |
|
124 | A | The number of positions | PROGRAMMING | 1,000 | [
"math"
] | null | null | Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy. | The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100). | Print the single number — the number of the sought positions. | [
"3 1 1\n",
"5 2 3\n"
] | [
"2\n",
"3\n"
] | The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5. | 500 | [
{
"input": "3 1 1",
"output": "2"
},
{
"input": "5 2 3",
"output": "3"
},
{
"input": "5 4 0",
"output": "1"
},
{
"input": "6 5 5",
"output": "1"
},
{
"input": "9 4 3",
"output": "4"
},
{
"input": "11 4 6",
"output": "7"
},
{
"input": "13 8 7",
"output": "5"
},
{
"input": "14 5 5",
"output": "6"
},
{
"input": "16 6 9",
"output": "10"
},
{
"input": "20 13 17",
"output": "7"
},
{
"input": "22 4 8",
"output": "9"
},
{
"input": "23 8 14",
"output": "15"
},
{
"input": "26 18 22",
"output": "8"
},
{
"input": "28 6 1",
"output": "2"
},
{
"input": "29 5 23",
"output": "24"
},
{
"input": "32 27 15",
"output": "5"
},
{
"input": "33 11 5",
"output": "6"
},
{
"input": "37 21 15",
"output": "16"
},
{
"input": "39 34 33",
"output": "5"
},
{
"input": "41 27 11",
"output": "12"
},
{
"input": "42 25 16",
"output": "17"
},
{
"input": "45 7 43",
"output": "38"
},
{
"input": "47 16 17",
"output": "18"
},
{
"input": "49 11 37",
"output": "38"
},
{
"input": "51 38 39",
"output": "13"
},
{
"input": "52 29 7",
"output": "8"
},
{
"input": "56 43 12",
"output": "13"
},
{
"input": "58 57 28",
"output": "1"
},
{
"input": "59 12 39",
"output": "40"
},
{
"input": "62 9 52",
"output": "53"
},
{
"input": "63 29 44",
"output": "34"
},
{
"input": "65 30 22",
"output": "23"
},
{
"input": "66 27 38",
"output": "39"
},
{
"input": "71 33 53",
"output": "38"
},
{
"input": "73 14 12",
"output": "13"
},
{
"input": "73 37 35",
"output": "36"
},
{
"input": "76 69 44",
"output": "7"
},
{
"input": "79 25 20",
"output": "21"
},
{
"input": "81 60 20",
"output": "21"
},
{
"input": "81 79 14",
"output": "2"
},
{
"input": "84 0 42",
"output": "43"
},
{
"input": "88 79 8",
"output": "9"
},
{
"input": "90 76 59",
"output": "14"
},
{
"input": "92 2 22",
"output": "23"
},
{
"input": "94 5 88",
"output": "89"
},
{
"input": "94 62 48",
"output": "32"
},
{
"input": "96 22 72",
"output": "73"
},
{
"input": "100 11 88",
"output": "89"
},
{
"input": "100 81 91",
"output": "19"
},
{
"input": "1 0 0",
"output": "1"
}
] | 1,697,371,881 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 60 | 0 | n=[int(x) for x in input().split()]
print(n[0]-n[1]) | Title: The number of positions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
Input Specification:
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
Output Specification:
Print the single number — the number of the sought positions.
Demo Input:
['3 1 1\n', '5 2 3\n']
Demo Output:
['2\n', '3\n']
Note:
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5. | ```python
n=[int(x) for x in input().split()]
print(n[0]-n[1])
``` | 0 |
|
23 | A | You're Given a String... | PROGRAMMING | 1,200 | [
"brute force",
"greedy"
] | A. You're Given a String... | 2 | 256 | You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2). | The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100. | Output one number — length of the longest substring that can be met in the string at least twice. | [
"abcd\n",
"ababa\n",
"zzz\n"
] | [
"0",
"3",
"2"
] | none | 0 | [
{
"input": "abcd",
"output": "0"
},
{
"input": "ababa",
"output": "3"
},
{
"input": "zzz",
"output": "2"
},
{
"input": "kmmm",
"output": "2"
},
{
"input": "wzznz",
"output": "1"
},
{
"input": "qlzazaaqll",
"output": "2"
},
{
"input": "lzggglgpep",
"output": "2"
},
{
"input": "iegdlraaidefgegiagrdfhihe",
"output": "2"
},
{
"input": "esxpqmdrtidgtkxojuxyrcwxlycywtzbjzpxvbngnlepgzcaeg",
"output": "1"
},
{
"input": "garvpaimjdjiivamusjdwfcaoswuhxyyxvrxzajoyihggvuxumaadycfphrzbprraicvjjlsdhojihaw",
"output": "2"
},
{
"input": "ckvfndqgkmhcyojaqgdkenmbexufryhqejdhctxujmtrwkpbqxufxamgoeigzfyzbhevpbkvviwntdhqscvkmphnkkljizndnbjt",
"output": "3"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "99"
},
{
"input": "ikiikiikikiiikkkkkikkkkiiiiikkiiikkiikiikkkkikkkikikkikiiikkikikiiikikkkiiikkkikkikkikkkkiiikkiiiiii",
"output": "10"
},
{
"input": "ovovhoovvhohhhvhhvhhvhovoohovhhoooooovohvooooohvvoooohvvovhhvhovhhvoovhvhvoovovvhooovhhooovohvhhovhv",
"output": "8"
},
{
"input": "ccwckkkycccccckwckwkwkwkkkkyycykcccycyckwywcckwykcycykkkwcycwwcykcwkwkwwykwkwcykywwwyyykckkyycckwcwk",
"output": "5"
},
{
"input": "ttketfkefktfztezzkzfkkeetkkfktftzktezekkeezkeeetteeteefetefkzzzetekfftkeffzkktffzkzzeftfeezfefzffeef",
"output": "4"
},
{
"input": "rtharczpfznrgdnkltchafduydgbgkdjqrmjqyfmpwjwphrtsjbmswkanjlprbnduaqbcjqxlxmkspkhkcnzbqwxonzxxdmoigti",
"output": "2"
},
{
"input": "fplrkfklvwdeiynbjgaypekambmbjfnoknlhczhkdmljicookdywdgpnlnqlpunnkebnikgcgcjefeqhknvlynmvjcegvcdgvvdb",
"output": "2"
},
{
"input": "txbciieycswqpniwvzipwlottivvnfsysgzvzxwbctcchfpvlbcjikdofhpvsknptpjdbxemtmjcimetkemdbettqnbvzzbdyxxb",
"output": "2"
},
{
"input": "fmubmfwefikoxtqvmaavwjxmoqltapexkqxcsztpezfcltqavuicefxovuswmqimuikoppgqpiapqutkczgcvxzutavkujxvpklv",
"output": "3"
},
{
"input": "ipsrjylhpkjvlzncfixipstwcicxqygqcfrawpzzvckoveyqhathglblhpkjvlzncfixipfajaqobtzvthmhgbuawoxoknirclxg",
"output": "15"
},
{
"input": "kcnjsntjzcbgzjscrsrjkrbytqsrptzspzctjrorsyggrtkcnjsntjzcbgzjscrsrjyqbrtpcgqirsrrjbbbrnyqstnrozcoztt",
"output": "20"
},
{
"input": "unhcfnrhsqetuerjqcetrhlsqgfnqfntvkgxsscquolxxroqgtchffyccetrhlsqgfnqfntvkgxsscquolxxroqgtchffhfqvx",
"output": "37"
},
{
"input": "kkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckkkkkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckckckkc",
"output": "46"
},
{
"input": "mlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydbrxdmlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydik",
"output": "47"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "0"
},
{
"input": "tttttbttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttmttttttt",
"output": "85"
},
{
"input": "ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffbfffffffffffffffffffffffffffffffffffff",
"output": "61"
},
{
"input": "cccccccccccccccccccccccwcccccccccccccccccccccuccccccccccccccnccccccccccccccccccccccccccccccccccccccc",
"output": "38"
},
{
"input": "ffffffffffffffffffffffffffufffgfffffffffffffffffffffffffffffffffffffffgffffffftffffffgffffffffffffff",
"output": "38"
},
{
"input": "rrrrrrrrrrrrrrrrrrrlhbrrrrrrrrurrrrrrrfrrqrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrewrrrrrrryrrxrrrrrrrrrrr",
"output": "33"
},
{
"input": "vyvvvvvvvvzvvvvvzvvvwvvvvrvvvvvvvvvvvvvvvrvvvvvvvvvpkvvpvgvvvvvvvvvvvvvgvvvvvvvvvvvvvvvvvvysvvvbvvvv",
"output": "17"
},
{
"input": "cbubbbbbbbbbbfbbbbbbbbjbobbbbbbbbbbibbubbbbjbbbnzgbbzbbfbbbbbbbbbbbfbpbbbbbbbbbbygbbbgbabbbbbbbhibbb",
"output": "12"
},
{
"input": "lrqrrrrrrrjrrrrrcdrrgrrmwvrrrrrrrrrxfzrmrmrryrrrurrrdrrrrrrrrrrererrrsrrrrrrrrrrrqrrrrcrrwjsrrlrrrrr",
"output": "10"
},
{
"input": "ssssusisisosscssssztzessssyspskjssvosiissussszsosssslsssdsssvssvsssslsssmsfjasjsssssowscsjsssszsspss",
"output": "8"
},
{
"input": "uukuuuumueuuuujuukgdhbztuuuubbguuocuozfaunqufjujuguyuuvkuuauubuubuucuvtjuuuuuusduduuuuuuuueunuuuuuzu",
"output": "7"
},
{
"input": "jpkkgwklngwqcfzmwkkpcwkkkkkekkkekkkdsykqwjkkkhkkkxdnukkkkkkmkqykkkxqklkskkrkkkkkqqjikkkkkkpknkkkkkoh",
"output": "7"
},
{
"input": "bmzbbfbbhqxwthtbbisbbbbbtbbfbbpbfbbpbkbjfbcbbbbzbbbdwmbbbrnvqdbbtbbuglrnbbbbvmbyblebbabibrevaxbbjbqb",
"output": "6"
},
{
"input": "qqqmqqqsbteqqopsuqiqumrqzpqnqgqeniqqkyqqyqqqpxzqeqqquhdqquhqqqfqjirqaqqaquxqoqqjqqqqbjbgqcqqqqicnkqc",
"output": "4"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaasaaaavaaaaaaauaaeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "44"
},
{
"input": "a",
"output": "0"
},
{
"input": "fg",
"output": "0"
},
{
"input": "yy",
"output": "1"
},
{
"input": "abcabcabc",
"output": "6"
},
{
"input": "qwerqwedqwes",
"output": "3"
}
] | 1,677,471,140 | 2,147,483,647 | Python 3 | OK | TESTS | 45 | 840 | 204,800 | a=input()
l=[]
n=0
for i in range(len(a)):
for j in range(i+1,len(a)+1):
l.append(a[i:j])
for i in l:
if l.count(i)>=2:
if len(i)>n:
n=len(i)
print(n)
| Title: You're Given a String...
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2).
Input Specification:
The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100.
Output Specification:
Output one number — length of the longest substring that can be met in the string at least twice.
Demo Input:
['abcd\n', 'ababa\n', 'zzz\n']
Demo Output:
['0', '3', '2']
Note:
none | ```python
a=input()
l=[]
n=0
for i in range(len(a)):
for j in range(i+1,len(a)+1):
l.append(a[i:j])
for i in l:
if l.count(i)>=2:
if len(i)>n:
n=len(i)
print(n)
``` | 3.789619 |
327 | A | Flipping Game | PROGRAMMING | 1,200 | [
"brute force",
"dp",
"implementation"
] | null | null | Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub. | The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1. | Print an integer — the maximal number of 1s that can be obtained after exactly one move. | [
"5\n1 0 0 1 0\n",
"4\n1 0 0 1\n"
] | [
"4\n",
"4\n"
] | In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1. | 500 | [
{
"input": "5\n1 0 0 1 0",
"output": "4"
},
{
"input": "4\n1 0 0 1",
"output": "4"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "8\n1 0 0 0 1 0 0 0",
"output": "7"
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "18"
},
{
"input": "23\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "22"
},
{
"input": "100\n0 1 0 1 1 1 0 1 0 1 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 0 0 1 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1",
"output": "70"
},
{
"input": "100\n0 1 1 0 1 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 0 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 0 0 0 1 0 0 0 0 1 1 1 1",
"output": "60"
},
{
"input": "18\n0 1 0 1 0 1 0 1 0 1 1 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "25\n0 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 1 1 1 0 0 1 1 0 1",
"output": "18"
},
{
"input": "55\n0 0 1 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 1 0 0 1 0 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 1 0 0 0 0 1 1 0 1 1 1 1",
"output": "36"
},
{
"input": "75\n1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 0 0 1 0 1 1 0 0 0 0 1 1 0 0 0 1 0 0 0",
"output": "44"
},
{
"input": "100\n0 0 1 0 1 0 0 1 1 0 1 1 0 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1 0 1",
"output": "61"
},
{
"input": "100\n0 0 0 1 0 0 0 1 0 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 0 1 0 0 1 1 0 1 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 1 1 0 1 1 0",
"output": "61"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "100\n0 0 1 1 1 0 1 1 0 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 1 1 1 1 0 1 0 0 1 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 0 0 0 1 0",
"output": "61"
},
{
"input": "100\n0 1 1 1 1 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 0 1 0 1 0 1 0 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 1 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "99\n1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 1 0 0 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1 0 0 0 0 0 1 0 1 1 1",
"output": "61"
},
{
"input": "2\n1 1",
"output": "1"
}
] | 1,695,460,182 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 92 | 0 | from math import *
n=int(input())
a=list(map(int,input().split()))
max=sum(a)
for i in range(1,len(a)+1):
q=a[0:i]
h=q.count(0)-q.count(1)
j=sum(a)
#print(q)
for u in range(i,len(a)):
#print(h,end=' ')
h+=(-1,1)[a[u]==0]
h-=(-1,1)[a[u-i]==0]
#print(u,i,a[u],a[u-i],h)
if max<j+h:
max=j+h
print(max) | Title: Flipping Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
Output Specification:
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
Demo Input:
['5\n1 0 0 1 0\n', '4\n1 0 0 1\n']
Demo Output:
['4\n', '4\n']
Note:
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1. | ```python
from math import *
n=int(input())
a=list(map(int,input().split()))
max=sum(a)
for i in range(1,len(a)+1):
q=a[0:i]
h=q.count(0)-q.count(1)
j=sum(a)
#print(q)
for u in range(i,len(a)):
#print(h,end=' ')
h+=(-1,1)[a[u]==0]
h-=(-1,1)[a[u-i]==0]
#print(u,i,a[u],a[u-i],h)
if max<j+h:
max=j+h
print(max)
``` | 0 |
|
281 | A | Word Capitalization | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged. | A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. | Output the given word after capitalization. | [
"ApPLe\n",
"konjac\n"
] | [
"ApPLe\n",
"Konjac\n"
] | none | 500 | [
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,695,913,570 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 62 | 0 | str=input();
if str[0]>='A' and str[0]<='Z':
print(str)
else:
print(str.title())
| Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none | ```python
str=input();
if str[0]>='A' and str[0]<='Z':
print(str)
else:
print(str.title())
``` | 0 |
|
219 | B | Special Offer! Super Price 999 Bourles! | PROGRAMMING | 1,400 | [
"implementation"
] | null | null | Polycarpus is an amateur businessman. Recently he was surprised to find out that the market for paper scissors is completely free! Without further ado, Polycarpus decided to start producing and selling such scissors.
Polycaprus calculated that the optimal celling price for such scissors would be *p* bourles. However, he read somewhere that customers are attracted by prices that say something like "Special Offer! Super price 999 bourles!". So Polycarpus decided to lower the price a little if it leads to the desired effect.
Polycarpus agrees to lower the price by no more than *d* bourles so that the number of nines at the end of the resulting price is maximum. If there are several ways to do it, he chooses the maximum possible price.
Note, Polycarpus counts only the trailing nines in a price. | The first line contains two integers *p* and *d* (1<=≤<=*p*<=≤<=1018; 0<=≤<=*d*<=<<=*p*) — the initial price of scissors and the maximum possible price reduction.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. | Print the required price — the maximum price that ends with the largest number of nines and that is less than *p* by no more than *d*.
The required number shouldn't have leading zeroes. | [
"1029 102\n",
"27191 17\n"
] | [
"999\n",
"27189\n"
] | none | 1,000 | [
{
"input": "1029 102",
"output": "999"
},
{
"input": "27191 17",
"output": "27189"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "9 0",
"output": "9"
},
{
"input": "20 1",
"output": "19"
},
{
"input": "100 23",
"output": "99"
},
{
"input": "10281 1",
"output": "10281"
},
{
"input": "2111 21",
"output": "2099"
},
{
"input": "3021 112",
"output": "2999"
},
{
"input": "1000000000000000000 999999999999999999",
"output": "999999999999999999"
},
{
"input": "29287101 301",
"output": "29286999"
},
{
"input": "302918113 8113",
"output": "302917999"
},
{
"input": "23483247283432 47283432",
"output": "23483239999999"
},
{
"input": "47283432 7283432",
"output": "46999999"
},
{
"input": "7283432 7283431",
"output": "6999999"
},
{
"input": "2304324853947 5853947",
"output": "2304319999999"
},
{
"input": "2485348653485 123483",
"output": "2485348599999"
},
{
"input": "29845435345 34543",
"output": "29845429999"
},
{
"input": "2348723847234234 234829384234",
"output": "2348699999999999"
},
{
"input": "2348723847234234 234829384234",
"output": "2348699999999999"
},
{
"input": "596383801524465437 13997918422040",
"output": "596379999999999999"
},
{
"input": "621306590487786841 47851896849379",
"output": "621299999999999999"
},
{
"input": "990575220328844835 100861359807341",
"output": "990499999999999999"
},
{
"input": "403277728241895842 15097810739041",
"output": "403269999999999999"
},
{
"input": "287854791214303304 98046359947548",
"output": "287799999999999999"
},
{
"input": "847222126505823289 115713658562976",
"output": "847199999999999999"
},
{
"input": "991096248227872657 181679439312637",
"output": "990999999999999999"
},
{
"input": "954402996235787062 354162450334047",
"output": "954399999999999999"
},
{
"input": "220466716596033408 44952575147901",
"output": "220459999999999999"
},
{
"input": "559198116944738707 844709119308273",
"output": "558999999999999999"
},
{
"input": "363980380443991024 4242310030748",
"output": "363979999999999999"
},
{
"input": "733498827000355608 13253459808159",
"output": "733489999999999999"
},
{
"input": "757663489894439901 139905688448459",
"output": "757599999999999999"
},
{
"input": "30528581170507487 1199546082507",
"output": "30527999999999999"
},
{
"input": "534463403123444176 67776394133861",
"output": "534399999999999999"
},
{
"input": "399943891120381720 89545256475298",
"output": "399899999999999999"
},
{
"input": "697076786191991245 95935185412097",
"output": "696999999999999999"
},
{
"input": "495773842562930245 17116719198640",
"output": "495769999999999999"
},
{
"input": "343540186435799067 48368225269792",
"output": "343499999999999999"
},
{
"input": "393776794010351632 4138311260892",
"output": "393775999999999999"
},
{
"input": "830005749156754342 157633405415940",
"output": "829999999999999999"
},
{
"input": "735716632509713228 109839072010906",
"output": "735699999999999999"
},
{
"input": "925835698451819219 232827103605000",
"output": "925799999999999999"
},
{
"input": "362064657893189225 54298707317247",
"output": "362059999999999999"
},
{
"input": "286739242579659245 61808986676984",
"output": "286699999999999999"
},
{
"input": "234522568185994645 14536016333590",
"output": "234519999999999999"
},
{
"input": "989980699593228598 382407804389880",
"output": "989899999999999999"
},
{
"input": "953287447601143003 367647762226264",
"output": "952999999999999999"
},
{
"input": "369834331957505226 421031521866991",
"output": "369799999999999999"
},
{
"input": "433225528653135646 16671330805568",
"output": "433219999999999999"
},
{
"input": "664584428369850915 516656201621892",
"output": "664499999999999999"
},
{
"input": "100813383516253625 468493737928751",
"output": "100799999999999999"
},
{
"input": "63600749936231318 12287109070881",
"output": "63599999999999999"
},
{
"input": "196643334958802150 3659421793154",
"output": "196639999999999999"
},
{
"input": "803015192835672406 14043666502157",
"output": "803009999999999999"
},
{
"input": "43201857567928862 5891486380570",
"output": "43199999999999999"
},
{
"input": "142195487377202511 32209508975060",
"output": "142189999999999999"
},
{
"input": "159171676706847083 28512592184962",
"output": "159169999999999999"
},
{
"input": "377788117133266645 12127036235155",
"output": "377779999999999999"
},
{
"input": "949501478909148807 31763408418934",
"output": "949499999999999999"
},
{
"input": "955412075341421601 220849506773896",
"output": "955399999999999999"
},
{
"input": "652742935922718161 11045914932687",
"output": "652739999999999999"
},
{
"input": "371621017875752909 511452352707014",
"output": "371599999999999999"
},
{
"input": "979748686171802330 281906901894586",
"output": "979699999999999999"
},
{
"input": "987860891213585005 85386263418762",
"output": "987799999999999999"
},
{
"input": "59225847802373220 8605552735740",
"output": "59219999999999999"
},
{
"input": "22532595810287625 1459945485391",
"output": "22531999999999999"
},
{
"input": "191654878233371957 258451919478343",
"output": "191599999999999999"
},
{
"input": "796937674525939896 892734175683845",
"output": "796899999999999999"
},
{
"input": "166564871934000326 22888347028438",
"output": "166559999999999999"
},
{
"input": "559198116944738707 84470911930827",
"output": "559189999999999999"
},
{
"input": "559198116944738707 8447091193082",
"output": "559189999999999999"
},
{
"input": "559198116944738707 844709119308",
"output": "559197999999999999"
},
{
"input": "559198116944738707 84470911930",
"output": "559198099999999999"
},
{
"input": "559198116944738707 8447091193",
"output": "559198109999999999"
},
{
"input": "559198116944738707 844709119",
"output": "559198116899999999"
},
{
"input": "559198116944738707 84470911",
"output": "559198116899999999"
},
{
"input": "559198116944738707 8447091",
"output": "559198116939999999"
},
{
"input": "559198116944738707 844709",
"output": "559198116943999999"
},
{
"input": "559198116944738707 84470",
"output": "559198116944699999"
},
{
"input": "559198116944738707 8447",
"output": "559198116944737999"
},
{
"input": "559198116944738707 844",
"output": "559198116944737999"
},
{
"input": "559198116944738707 84",
"output": "559198116944738699"
},
{
"input": "559198116944738707 8",
"output": "559198116944738699"
},
{
"input": "559198116944738707 7",
"output": "559198116944738707"
},
{
"input": "559198116944738707 6",
"output": "559198116944738707"
},
{
"input": "559198116944738707 1",
"output": "559198116944738707"
},
{
"input": "559198116944738707 0",
"output": "559198116944738707"
},
{
"input": "559198116944738700 1",
"output": "559198116944738699"
},
{
"input": "559198116944738700 0",
"output": "559198116944738700"
},
{
"input": "559198116944738999 0",
"output": "559198116944738999"
},
{
"input": "559198116944738999 1",
"output": "559198116944738999"
},
{
"input": "199 100",
"output": "199"
},
{
"input": "99 10",
"output": "99"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "18 17",
"output": "9"
},
{
"input": "199 198",
"output": "199"
},
{
"input": "1000000000000000000 0",
"output": "1000000000000000000"
},
{
"input": "59 3",
"output": "59"
},
{
"input": "9999 10",
"output": "9999"
},
{
"input": "999999999999999998 999999999999999997",
"output": "899999999999999999"
},
{
"input": "8 7",
"output": "8"
}
] | 1,686,324,660 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 102 | 124 | 0 | p, d = map(int,input().split())
i, dis = 1, 0
while p%(10**i) + 1 <= d :
if (p%(10**i) + 1)%10**i == 0 :
i += 1
continue
dis = p%(10**i) + 1
i += 1
print(p-dis) | Title: Special Offer! Super Price 999 Bourles!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus is an amateur businessman. Recently he was surprised to find out that the market for paper scissors is completely free! Without further ado, Polycarpus decided to start producing and selling such scissors.
Polycaprus calculated that the optimal celling price for such scissors would be *p* bourles. However, he read somewhere that customers are attracted by prices that say something like "Special Offer! Super price 999 bourles!". So Polycarpus decided to lower the price a little if it leads to the desired effect.
Polycarpus agrees to lower the price by no more than *d* bourles so that the number of nines at the end of the resulting price is maximum. If there are several ways to do it, he chooses the maximum possible price.
Note, Polycarpus counts only the trailing nines in a price.
Input Specification:
The first line contains two integers *p* and *d* (1<=≤<=*p*<=≤<=1018; 0<=≤<=*d*<=<<=*p*) — the initial price of scissors and the maximum possible price reduction.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Output Specification:
Print the required price — the maximum price that ends with the largest number of nines and that is less than *p* by no more than *d*.
The required number shouldn't have leading zeroes.
Demo Input:
['1029 102\n', '27191 17\n']
Demo Output:
['999\n', '27189\n']
Note:
none | ```python
p, d = map(int,input().split())
i, dis = 1, 0
while p%(10**i) + 1 <= d :
if (p%(10**i) + 1)%10**i == 0 :
i += 1
continue
dis = p%(10**i) + 1
i += 1
print(p-dis)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Imagine you have an infinite 2D plane with Cartesian coordinate system. Some of the integral points are blocked, and others are not. Two integral points *A* and *B* on the plane are 4-connected if and only if:
- the Euclidean distance between *A* and *B* is one unit and neither *A* nor *B* is blocked; - or there is some integral point *C*, such that *A* is 4-connected with *C*, and *C* is 4-connected with *B*.
Let's assume that the plane doesn't contain blocked points. Consider all the integral points of the plane whose Euclidean distance from the origin is no more than *n*, we'll name these points special. Chubby Yang wants to get the following property: no special point is 4-connected to some non-special point. To get the property she can pick some integral points of the plane and make them blocked. What is the minimum number of points she needs to pick? | The first line contains an integer *n* (0<=≤<=*n*<=≤<=4·107). | Print a single integer — the minimum number of points that should be blocked. | [
"1\n",
"2\n",
"3\n"
] | [
"4\n",
"8\n",
"16\n"
] | none | 0 | [
{
"input": "1",
"output": "4"
},
{
"input": "2",
"output": "8"
},
{
"input": "3",
"output": "16"
},
{
"input": "4",
"output": "20"
},
{
"input": "0",
"output": "1"
},
{
"input": "30426905",
"output": "172120564"
},
{
"input": "38450759",
"output": "217510336"
},
{
"input": "743404",
"output": "4205328"
},
{
"input": "3766137",
"output": "21304488"
},
{
"input": "19863843",
"output": "112366864"
},
{
"input": "24562258",
"output": "138945112"
},
{
"input": "24483528",
"output": "138499748"
},
{
"input": "25329968",
"output": "143287936"
},
{
"input": "31975828",
"output": "180882596"
},
{
"input": "2346673",
"output": "13274784"
},
{
"input": "17082858",
"output": "96635236"
},
{
"input": "22578061",
"output": "127720800"
},
{
"input": "17464436",
"output": "98793768"
},
{
"input": "18855321",
"output": "106661800"
},
{
"input": "614109",
"output": "3473924"
},
{
"input": "3107977",
"output": "17581372"
},
{
"input": "39268638",
"output": "222136960"
},
{
"input": "31416948",
"output": "177721092"
},
{
"input": "34609610",
"output": "195781516"
},
{
"input": "17590047",
"output": "99504332"
},
{
"input": "12823666",
"output": "72541608"
},
{
"input": "34714265",
"output": "196373536"
},
{
"input": "2870141",
"output": "16235968"
},
{
"input": "15012490",
"output": "84923464"
},
{
"input": "31988776",
"output": "180955840"
},
{
"input": "1059264",
"output": "5992100"
},
{
"input": "5626785",
"output": "31829900"
},
{
"input": "33146037",
"output": "187502300"
},
{
"input": "17",
"output": "96"
},
{
"input": "40000000",
"output": "226274168"
},
{
"input": "5",
"output": "28"
},
{
"input": "6",
"output": "32"
},
{
"input": "7",
"output": "36"
},
{
"input": "8",
"output": "44"
},
{
"input": "9",
"output": "48"
},
{
"input": "10",
"output": "56"
},
{
"input": "11",
"output": "60"
},
{
"input": "12",
"output": "64"
},
{
"input": "13",
"output": "72"
},
{
"input": "14",
"output": "76"
},
{
"input": "15",
"output": "84"
},
{
"input": "16",
"output": "88"
},
{
"input": "25",
"output": "140"
},
{
"input": "39999999",
"output": "226274164"
},
{
"input": "39999998",
"output": "226274156"
},
{
"input": "39999997",
"output": "226274152"
},
{
"input": "39999996",
"output": "226274144"
},
{
"input": "39099999",
"output": "221182992"
},
{
"input": "46340",
"output": "262136"
},
{
"input": "46341",
"output": "262144"
},
{
"input": "395938",
"output": "2239760"
}
] | 1,657,418,077 | 1,357 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | n=int(input())
ans=pow(2,n+1)
print(ans) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine you have an infinite 2D plane with Cartesian coordinate system. Some of the integral points are blocked, and others are not. Two integral points *A* and *B* on the plane are 4-connected if and only if:
- the Euclidean distance between *A* and *B* is one unit and neither *A* nor *B* is blocked; - or there is some integral point *C*, such that *A* is 4-connected with *C*, and *C* is 4-connected with *B*.
Let's assume that the plane doesn't contain blocked points. Consider all the integral points of the plane whose Euclidean distance from the origin is no more than *n*, we'll name these points special. Chubby Yang wants to get the following property: no special point is 4-connected to some non-special point. To get the property she can pick some integral points of the plane and make them blocked. What is the minimum number of points she needs to pick?
Input Specification:
The first line contains an integer *n* (0<=≤<=*n*<=≤<=4·107).
Output Specification:
Print a single integer — the minimum number of points that should be blocked.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['4\n', '8\n', '16\n']
Note:
none | ```python
n=int(input())
ans=pow(2,n+1)
print(ans)
``` | 0 |
|
665 | C | Simple Strings | PROGRAMMING | 1,300 | [
"dp",
"greedy",
"strings"
] | null | null | zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task! | The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters. | Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters. | [
"aab\n",
"caaab\n",
"zscoder\n"
] | [
"bab\n",
"cabab\n",
"zscoder\n"
] | none | 0 | [
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,641,642,492 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 6 | 77 | 0 | s=input()
t1=list(s)
s1=0
e="abcdefghijklmnopqrstuvwxyz"
for i in range(1,len(s),2):
if i+1<len(s):
if s[i]==s[i-1] or s[i]==s[i+1]:
j=0
while e[j]==s[i-1] or e[j]==s[i+1]:
j+=1
t1[i]=e[j]
s1+=1
else:
if s[i]==s[i-1]:
j=0
while e[j]==s[i-1]:
j+=1
t1[i]=e[j]
s1+=1
s2=0
t2=list(s)
for i in range(0,len(s),2):
if i+1<len(s):
if s[i]==s[i-1] or s[i]==s[i+1]:
j=0
while e[j]==s[i-1] or e[j]==s[i+1]:
j+=1
t2[i]=e[j]
s2+=1
else:
if s[i]==s[i-1]:
j=0
while e[j]==s[i-1]:
j+=1
t2[i]=e[j]
s2+=1
s=""
if s1>=s2:
for i in range(len(t2)):
s+=t2[i]
else:
for i in range(len(t1)):
s+=t1[i]
print(s) | Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none | ```python
s=input()
t1=list(s)
s1=0
e="abcdefghijklmnopqrstuvwxyz"
for i in range(1,len(s),2):
if i+1<len(s):
if s[i]==s[i-1] or s[i]==s[i+1]:
j=0
while e[j]==s[i-1] or e[j]==s[i+1]:
j+=1
t1[i]=e[j]
s1+=1
else:
if s[i]==s[i-1]:
j=0
while e[j]==s[i-1]:
j+=1
t1[i]=e[j]
s1+=1
s2=0
t2=list(s)
for i in range(0,len(s),2):
if i+1<len(s):
if s[i]==s[i-1] or s[i]==s[i+1]:
j=0
while e[j]==s[i-1] or e[j]==s[i+1]:
j+=1
t2[i]=e[j]
s2+=1
else:
if s[i]==s[i-1]:
j=0
while e[j]==s[i-1]:
j+=1
t2[i]=e[j]
s2+=1
s=""
if s1>=s2:
for i in range(len(t2)):
s+=t2[i]
else:
for i in range(len(t1)):
s+=t1[i]
print(s)
``` | 0 |
|
779 | A | Pupils Redistribution | PROGRAMMING | 1,000 | [
"constructive algorithms",
"math"
] | null | null | In Berland each high school student is characterized by academic performance — integer value between 1 and 5.
In high school 0xFF there are two groups of pupils: the group *A* and the group *B*. Each group consists of exactly *n* students. An academic performance of each student is known — integer value between 1 and 5.
The school director wants to redistribute students between groups so that each of the two groups has the same number of students whose academic performance is equal to 1, the same number of students whose academic performance is 2 and so on. In other words, the purpose of the school director is to change the composition of groups, so that for each value of academic performance the numbers of students in both groups are equal.
To achieve this, there is a plan to produce a series of exchanges of students between groups. During the single exchange the director selects one student from the class *A* and one student of class *B*. After that, they both change their groups.
Print the least number of exchanges, in order to achieve the desired equal numbers of students for each academic performance. | The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=100) — number of students in both groups.
The second line contains sequence of integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=5), where *a**i* is academic performance of the *i*-th student of the group *A*.
The third line contains sequence of integer numbers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=5), where *b**i* is academic performance of the *i*-th student of the group *B*. | Print the required minimum number of exchanges or -1, if the desired distribution of students can not be obtained. | [
"4\n5 4 4 4\n5 5 4 5\n",
"6\n1 1 1 1 1 1\n5 5 5 5 5 5\n",
"1\n5\n3\n",
"9\n3 2 5 5 2 3 3 3 2\n4 1 4 1 1 2 4 4 1\n"
] | [
"1\n",
"3\n",
"-1\n",
"4\n"
] | none | 500 | [
{
"input": "4\n5 4 4 4\n5 5 4 5",
"output": "1"
},
{
"input": "6\n1 1 1 1 1 1\n5 5 5 5 5 5",
"output": "3"
},
{
"input": "1\n5\n3",
"output": "-1"
},
{
"input": "9\n3 2 5 5 2 3 3 3 2\n4 1 4 1 1 2 4 4 1",
"output": "4"
},
{
"input": "1\n1\n2",
"output": "-1"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "8\n1 1 2 2 3 3 4 4\n4 4 5 5 1 1 1 1",
"output": "2"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1\n2 2 2 2 2 2 2 2 2 2",
"output": "5"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "0"
},
{
"input": "2\n1 1\n1 1",
"output": "0"
},
{
"input": "2\n1 2\n1 1",
"output": "-1"
},
{
"input": "2\n2 2\n1 1",
"output": "1"
},
{
"input": "2\n1 2\n2 1",
"output": "0"
},
{
"input": "2\n1 1\n2 2",
"output": "1"
},
{
"input": "5\n5 5 5 5 5\n5 5 5 5 5",
"output": "0"
},
{
"input": "5\n5 5 5 3 5\n5 3 5 5 5",
"output": "0"
},
{
"input": "5\n2 3 2 3 3\n2 3 2 2 2",
"output": "1"
},
{
"input": "5\n4 4 1 4 2\n1 2 4 2 2",
"output": "1"
},
{
"input": "50\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "50\n1 3 1 3 3 3 1 3 3 3 3 1 1 1 3 3 3 1 3 1 1 1 3 1 3 1 3 3 3 1 3 1 1 3 3 3 1 1 1 1 3 3 1 1 1 3 3 1 1 1\n1 3 1 3 3 1 1 3 1 3 3 1 1 1 1 3 3 1 3 1 1 3 1 1 3 1 1 1 1 3 3 1 3 3 3 3 1 3 3 3 3 3 1 1 3 3 1 1 3 1",
"output": "0"
},
{
"input": "50\n1 1 1 4 1 1 4 1 4 1 1 4 1 1 4 1 1 4 1 1 4 1 4 4 4 1 1 4 1 4 4 4 4 4 4 4 1 4 1 1 1 1 4 1 4 4 1 1 1 4\n1 4 4 1 1 4 1 4 4 1 1 4 1 4 1 1 4 1 1 1 4 4 1 1 4 1 4 1 1 4 4 4 4 1 1 4 4 1 1 1 4 1 4 1 4 1 1 1 4 4",
"output": "0"
},
{
"input": "50\n3 5 1 3 3 4 3 4 2 5 2 1 2 2 5 5 4 5 4 2 1 3 4 2 3 3 3 2 4 3 5 5 5 5 5 5 2 5 2 2 5 4 4 1 5 3 4 2 1 3\n3 5 3 2 5 3 4 4 5 2 3 4 4 4 2 2 4 4 4 3 3 5 5 4 3 1 4 4 5 5 4 1 2 5 5 4 1 2 3 4 5 5 3 2 3 4 3 5 1 1",
"output": "3"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "0"
},
{
"input": "100\n1 1 3 1 3 1 1 3 1 1 3 1 3 1 1 3 3 3 3 3 3 3 3 3 3 3 3 1 3 3 1 1 1 3 1 1 1 3 1 1 3 3 1 3 3 1 3 1 3 3 3 3 1 1 3 3 3 1 1 3 1 3 3 3 1 3 3 3 3 3 1 3 3 3 3 1 3 1 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 1 1 3 1 1 1\n1 1 1 3 3 3 3 3 3 3 1 3 3 3 1 3 3 3 3 3 3 1 3 3 1 3 3 1 1 1 3 3 3 3 3 3 3 1 1 3 3 3 1 1 3 3 1 1 1 3 3 3 1 1 3 1 1 3 3 1 1 3 3 3 3 3 3 1 3 3 3 1 1 3 3 3 1 1 3 3 1 3 1 3 3 1 1 3 3 1 1 3 1 3 3 3 1 3 1 3",
"output": "0"
},
{
"input": "100\n2 4 5 2 5 5 4 4 5 4 4 5 2 5 5 4 5 2 5 2 2 4 5 4 4 4 2 4 2 2 4 2 4 2 2 2 4 5 5 5 4 2 4 5 4 4 2 5 4 2 5 4 5 4 5 4 5 5 5 4 2 2 4 5 2 5 5 2 5 2 4 4 4 5 5 2 2 2 4 4 2 2 2 5 5 2 2 4 5 4 2 4 4 2 5 2 4 4 4 4\n4 4 2 5 2 2 4 2 5 2 5 4 4 5 2 4 5 4 5 2 2 2 2 5 4 5 2 4 2 2 5 2 5 2 4 5 5 5 2 5 4 4 4 4 5 2 2 4 2 4 2 4 5 5 5 4 5 4 5 5 5 2 5 4 4 4 4 4 2 5 5 4 2 4 4 5 5 2 4 4 4 2 2 2 5 4 2 2 4 5 4 4 4 4 2 2 4 5 5 2",
"output": "0"
},
{
"input": "100\n3 3 4 3 3 4 3 1 4 2 1 3 1 1 2 4 4 4 4 1 1 4 1 4 4 1 1 2 3 3 3 2 4 2 3 3 3 1 3 4 2 2 1 3 4 4 3 2 2 2 4 2 1 2 1 2 2 1 1 4 2 1 3 2 4 4 4 2 3 1 3 1 3 2 2 2 2 4 4 1 3 1 1 4 2 3 3 4 4 2 4 4 2 4 3 3 1 3 2 4\n3 1 4 4 2 1 1 1 1 1 1 3 1 1 3 4 3 2 2 4 2 1 4 4 4 4 1 2 3 4 2 3 3 4 3 3 2 4 2 2 2 1 2 4 4 4 2 1 3 4 3 3 4 2 4 4 3 2 4 2 4 2 4 4 1 4 3 1 4 3 3 3 3 1 2 2 2 2 4 1 2 1 3 4 3 1 3 3 4 2 3 3 2 1 3 4 2 1 1 2",
"output": "0"
},
{
"input": "100\n2 4 5 2 1 5 5 2 1 5 1 5 1 1 1 3 4 5 1 1 2 3 3 1 5 5 4 4 4 1 1 1 5 2 3 5 1 2 2 1 1 1 2 2 1 2 4 4 5 1 3 2 5 3 5 5 3 2 2 2 1 3 4 4 4 4 4 5 3 1 4 1 5 4 4 5 4 5 2 4 4 3 1 2 1 4 5 3 3 3 3 2 2 2 3 5 3 1 3 4\n3 2 5 1 5 4 4 3 5 5 5 2 1 4 4 3 2 3 3 5 5 4 5 5 2 1 2 4 4 3 5 1 1 5 1 3 2 5 2 4 4 2 4 2 4 2 3 2 5 1 4 4 1 1 1 5 3 5 1 1 4 5 1 1 2 2 5 3 5 1 1 1 2 3 3 2 3 2 4 4 5 4 2 1 3 4 1 1 2 4 1 5 3 1 2 1 3 4 1 3",
"output": "0"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "0"
},
{
"input": "100\n1 4 4 1 4 4 1 1 4 1 1 1 1 4 4 4 4 1 1 1 1 1 1 4 4 4 1 1 4 4 1 1 1 1 4 4 4 4 4 1 1 4 4 1 1 1 4 1 1 1 1 4 4 4 4 4 4 1 4 4 4 4 1 1 1 4 1 4 1 1 1 1 4 1 1 1 4 4 4 1 4 4 1 4 4 4 4 4 1 4 1 1 4 1 4 1 1 1 4 4\n4 1 1 4 4 4 1 4 4 4 1 1 4 1 1 4 1 4 4 4 1 1 4 1 4 1 1 1 4 4 1 4 1 4 1 4 4 1 1 4 1 4 1 1 1 4 1 4 4 4 1 4 1 4 4 4 4 1 4 1 1 4 1 1 4 4 4 1 4 1 4 1 4 4 4 1 1 4 1 4 4 4 4 1 1 1 1 1 4 4 1 4 1 4 1 1 1 4 4 1",
"output": "1"
},
{
"input": "100\n5 2 5 2 2 3 3 2 5 3 2 5 3 3 3 5 2 2 5 5 3 3 5 3 2 2 2 3 2 2 2 2 3 5 3 3 2 3 2 5 3 3 5 3 2 2 5 5 5 5 5 2 3 2 2 2 2 3 2 5 2 2 2 3 5 5 5 3 2 2 2 3 5 3 2 5 5 3 5 5 5 3 2 5 2 3 5 3 2 5 5 3 5 2 3 3 2 2 2 2\n5 3 5 3 3 5 2 5 3 2 3 3 5 2 5 2 2 5 2 5 2 5 3 3 5 3 2 2 2 3 5 3 2 2 3 2 2 5 5 2 3 2 3 3 5 3 2 5 2 2 2 3 3 5 3 3 5 2 2 2 3 3 2 2 3 5 3 5 5 3 3 2 5 3 5 2 3 2 5 5 3 2 5 5 2 2 2 2 3 2 2 5 2 5 2 2 3 3 2 5",
"output": "1"
},
{
"input": "100\n4 4 5 4 3 5 5 2 4 5 5 5 3 4 4 2 5 2 5 3 3 3 3 5 3 2 2 2 4 4 4 4 3 3 4 5 3 2 2 2 4 4 5 3 4 5 4 5 5 2 4 2 5 2 3 4 4 5 2 2 4 4 5 5 5 3 5 4 5 5 5 4 3 3 2 4 3 5 5 5 2 4 2 5 4 3 5 3 2 3 5 2 5 2 2 5 4 5 4 3\n5 4 2 4 3 5 2 5 5 3 4 5 4 5 3 3 5 5 2 3 4 2 3 5 2 2 2 4 2 5 2 4 4 5 2 2 4 4 5 5 2 3 4 2 4 5 2 5 2 2 4 5 5 3 5 5 5 4 3 4 4 3 5 5 3 4 5 3 2 3 4 3 4 4 2 5 3 4 5 5 3 5 3 3 4 3 5 3 2 2 4 5 4 5 5 2 3 4 3 5",
"output": "1"
},
{
"input": "100\n1 4 2 2 2 1 4 5 5 5 4 4 5 5 1 3 2 1 4 5 2 3 4 4 5 4 4 4 4 5 1 3 5 5 3 3 3 3 5 1 4 3 5 1 2 4 1 3 5 5 1 3 3 3 1 3 5 4 4 2 2 5 5 5 2 3 2 5 1 3 5 4 5 3 2 2 3 2 3 3 2 5 2 4 2 3 4 1 3 1 3 1 5 1 5 2 3 5 4 5\n1 2 5 3 2 3 4 2 5 1 2 5 3 4 3 3 4 1 5 5 1 3 3 1 1 4 1 4 2 5 4 1 3 4 5 3 2 2 1 4 5 5 2 3 3 5 5 4 2 3 3 5 3 3 5 4 4 5 3 5 1 1 4 4 4 1 3 5 5 5 4 2 4 5 3 2 2 2 5 5 5 1 4 3 1 3 1 2 2 4 5 1 3 2 4 5 1 5 2 5",
"output": "1"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n5 2 2 2 5 2 5 5 5 2 5 2 5 5 5 5 5 5 2 2 2 5 5 2 5 2 2 5 2 5 5 2 5 2 5 2 5 5 5 5 5 2 2 2 2 5 5 2 5 5 5 2 5 5 5 2 5 5 5 2 2 2 5 2 2 2 5 5 2 5 5 5 2 5 2 2 5 2 2 2 5 5 5 5 2 5 2 5 2 2 5 2 5 2 2 2 2 5 5 2\n5 5 2 2 5 5 2 5 2 2 5 5 5 5 2 5 5 2 5 2 2 5 2 2 5 2 5 2 2 5 2 5 2 5 5 2 2 5 5 5 2 5 5 2 5 5 5 2 2 5 5 5 2 5 5 5 2 2 2 5 5 5 2 2 5 5 2 2 2 5 2 5 5 2 5 2 5 2 2 5 5 2 2 5 5 2 2 5 2 2 5 2 2 2 5 5 2 2 2 5",
"output": "1"
},
{
"input": "100\n3 3 2 2 1 2 3 3 2 2 1 1 3 3 1 1 1 2 1 2 3 2 3 3 3 1 2 3 1 2 1 2 3 3 2 1 1 1 1 1 2 2 3 2 1 1 3 3 1 3 3 1 3 1 3 3 3 2 1 2 3 1 3 2 2 2 2 2 2 3 1 3 1 2 2 1 2 3 2 3 3 1 2 1 1 3 1 1 1 2 1 2 2 2 3 2 3 2 1 1\n1 3 1 2 1 1 1 1 1 2 1 2 1 3 2 2 3 2 1 1 2 2 2 1 1 3 2 3 2 1 2 2 3 2 3 1 3 1 1 2 3 1 2 1 3 2 1 2 3 2 3 3 3 2 2 2 3 1 3 1 1 2 1 3 1 3 1 3 3 3 1 3 3 2 1 3 3 3 3 3 2 1 2 2 3 3 2 1 2 2 1 3 3 1 3 2 2 1 1 3",
"output": "1"
},
{
"input": "100\n5 3 3 2 5 3 2 4 2 3 3 5 3 4 5 4 3 3 4 3 2 3 3 4 5 4 2 4 2 4 5 3 3 4 5 3 5 3 5 3 3 2 5 3 4 5 2 5 2 2 4 2 2 2 2 5 4 5 4 3 5 4 2 5 5 3 4 5 2 3 2 2 2 5 3 2 2 2 3 3 5 2 3 2 4 5 3 3 3 5 2 3 3 3 5 4 5 5 5 2\n4 4 4 5 5 3 5 5 4 3 5 4 3 4 3 3 5 3 5 5 3 3 3 5 5 4 4 3 2 5 4 3 3 4 5 3 5 2 4 2 2 2 5 3 5 2 5 5 3 3 2 3 3 4 2 5 2 5 2 4 2 4 2 3 3 4 2 2 2 4 4 3 3 3 4 3 3 3 5 5 3 4 2 2 3 5 5 2 3 4 5 4 5 3 4 2 5 3 2 4",
"output": "3"
},
{
"input": "100\n5 3 4 4 2 5 1 1 4 4 3 5 5 1 4 4 2 5 3 2 1 1 3 2 4 4 4 2 5 2 2 3 1 4 1 4 4 5 3 5 1 4 1 4 1 5 5 3 5 5 1 5 3 5 1 3 3 4 5 3 2 2 4 5 2 5 4 2 4 4 1 1 4 2 4 1 2 2 4 3 4 1 1 1 4 3 5 1 2 1 4 5 4 4 2 1 4 1 3 2\n1 1 1 1 4 2 1 4 1 1 3 5 4 3 5 2 2 4 2 2 4 1 3 4 4 5 1 1 2 2 2 1 4 1 4 4 1 5 5 2 3 5 1 5 4 2 3 2 2 5 4 1 1 4 5 2 4 5 4 4 3 3 2 4 3 4 5 5 4 2 4 2 1 2 3 2 2 5 5 3 1 3 4 3 4 4 5 3 1 1 3 5 1 4 4 2 2 1 4 5",
"output": "2"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n3 3 4 3 3 4 3 3 4 4 3 3 3 4 3 4 3 4 4 3 3 3 3 3 3 4 3 3 4 3 3 3 3 4 3 3 3 4 4 4 3 3 4 4 4 3 4 4 3 3 4 3 3 3 4 4 4 3 4 3 3 3 3 3 3 3 4 4 3 3 3 3 4 3 3 3 3 3 4 4 3 3 3 3 3 4 3 4 4 4 4 3 4 3 4 4 4 4 3 3\n4 3 3 3 3 4 4 3 4 4 4 3 3 4 4 3 4 4 4 4 3 4 3 3 3 4 4 4 3 4 3 4 4 3 3 4 3 3 3 3 3 4 3 3 3 3 4 4 4 3 3 4 3 4 4 4 4 3 4 4 3 3 4 3 3 4 3 4 3 4 4 4 4 3 3 4 3 4 4 4 3 3 4 4 4 4 4 3 3 3 4 3 3 4 3 3 3 3 3 3",
"output": "5"
},
{
"input": "100\n4 2 5 2 5 4 2 5 5 4 4 2 4 4 2 4 4 5 2 5 5 2 2 4 4 5 4 5 5 5 2 2 2 2 4 4 5 2 4 4 4 2 2 5 5 4 5 4 4 2 4 5 4 2 4 5 4 2 4 5 4 4 4 4 4 5 4 2 5 2 5 5 5 5 4 2 5 5 4 4 2 5 2 5 2 5 4 2 4 2 4 5 2 5 2 4 2 4 2 4\n5 4 5 4 5 2 2 4 5 2 5 5 5 5 5 4 4 4 4 5 4 5 5 2 4 4 4 4 5 2 4 4 5 5 2 5 2 5 5 4 4 5 2 5 2 5 2 5 4 5 2 5 2 5 2 4 4 5 4 2 5 5 4 2 2 2 5 4 2 2 4 4 4 5 5 2 5 2 2 4 4 4 2 5 4 5 2 2 5 4 4 5 5 4 5 5 4 5 2 5",
"output": "5"
},
{
"input": "100\n3 4 5 3 5 4 5 4 4 4 2 4 5 4 3 2 3 4 3 5 2 5 2 5 4 3 4 2 5 2 5 3 4 5 2 5 4 2 4 5 4 3 2 4 4 5 2 5 5 3 3 5 2 4 4 2 3 3 2 5 5 5 2 4 5 5 4 2 2 5 3 3 2 4 4 2 4 5 5 2 5 5 3 2 5 2 4 4 3 3 5 4 5 5 2 5 4 5 4 3\n4 3 5 5 2 4 2 4 5 5 5 2 3 3 3 3 5 5 5 5 3 5 2 3 5 2 3 2 2 5 5 3 5 3 4 2 2 5 3 3 3 3 5 2 4 5 3 5 3 4 4 4 5 5 3 4 4 2 2 4 4 5 3 2 4 5 5 4 5 2 2 3 5 4 5 5 2 5 4 3 2 3 2 5 4 5 3 4 5 5 3 5 2 2 4 4 3 2 5 2",
"output": "4"
},
{
"input": "100\n4 1 1 2 1 4 4 1 4 5 5 5 2 2 1 3 5 2 1 5 2 1 2 4 4 2 1 2 2 2 4 3 1 4 2 2 3 1 1 4 4 5 4 4 4 5 1 4 1 4 3 1 2 1 2 4 1 2 5 2 1 4 3 4 1 4 2 1 1 1 5 3 3 1 4 1 3 1 4 1 1 2 2 2 3 1 4 3 4 4 5 2 5 4 3 3 3 2 2 1\n5 1 4 4 3 4 4 5 2 3 3 4 4 2 3 2 3 1 3 1 1 4 1 5 4 3 2 4 3 3 3 2 3 4 1 5 4 2 4 2 2 2 5 3 1 2 5 3 2 2 1 1 2 2 3 5 1 2 5 3 2 1 1 2 1 2 4 3 5 4 5 3 2 4 1 3 4 1 4 4 5 4 4 5 4 2 5 3 4 1 4 2 4 2 4 5 4 5 4 2",
"output": "6"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1 4 4 4 4 4 4 4 4 4 4\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "0"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 4 3 3 3 3 3 3 3 3 3 3 1 3 1 3 3 3 3 1 1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3\n3 3 3 4 3 3 3 1 1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 1 3 3 3 1 3 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 1 3 3 3 3 3 3 1 3 3 3 3 3 3 3 3 3 3",
"output": "1"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5\n3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1 3 1",
"output": "25"
},
{
"input": "100\n3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5 3 5\n2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4 2 4",
"output": "50"
},
{
"input": "100\n1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "40"
},
{
"input": "100\n1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5 1 2 3 4 5\n2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3 2 3",
"output": "30"
},
{
"input": "5\n4 4 4 4 5\n4 5 5 5 5",
"output": "-1"
},
{
"input": "4\n1 1 1 1\n3 3 3 3",
"output": "2"
},
{
"input": "6\n1 1 2 2 3 4\n1 2 3 3 4 4",
"output": "-1"
},
{
"input": "4\n1 1 1 2\n3 3 3 3",
"output": "-1"
},
{
"input": "3\n2 2 2\n4 4 4",
"output": "-1"
},
{
"input": "2\n1 2\n3 4",
"output": "-1"
},
{
"input": "6\n1 1 1 3 3 3\n2 2 2 4 4 4",
"output": "-1"
},
{
"input": "5\n1 2 2 2 2\n1 1 1 1 3",
"output": "-1"
},
{
"input": "2\n1 3\n2 2",
"output": "-1"
},
{
"input": "2\n1 3\n4 5",
"output": "-1"
},
{
"input": "4\n1 2 3 4\n5 5 5 5",
"output": "-1"
},
{
"input": "2\n1 3\n2 4",
"output": "-1"
},
{
"input": "2\n1 2\n4 4",
"output": "-1"
},
{
"input": "2\n1 2\n3 3",
"output": "-1"
},
{
"input": "10\n4 4 4 4 2 3 3 3 3 1\n2 2 2 2 4 1 1 1 1 3",
"output": "-1"
},
{
"input": "6\n1 2 3 3 4 4\n1 1 2 2 3 4",
"output": "-1"
},
{
"input": "5\n3 3 3 3 1\n1 1 1 1 3",
"output": "-1"
},
{
"input": "2\n1 1\n2 3",
"output": "-1"
},
{
"input": "8\n1 1 2 2 3 3 3 3\n2 2 2 2 1 1 1 1",
"output": "2"
},
{
"input": "5\n1 1 1 3 3\n1 1 1 1 2",
"output": "-1"
},
{
"input": "6\n2 2 3 3 4 4\n2 3 4 5 5 5",
"output": "-1"
},
{
"input": "6\n1 1 2 2 3 4\n3 3 4 4 1 2",
"output": "-1"
},
{
"input": "4\n1 2 3 3\n3 3 3 3",
"output": "-1"
},
{
"input": "3\n1 2 3\n3 3 3",
"output": "-1"
},
{
"input": "5\n3 3 3 2 2\n2 2 2 3 3",
"output": "-1"
},
{
"input": "10\n1 2 3 4 1 2 3 4 1 2\n1 2 3 4 1 2 3 4 3 4",
"output": "-1"
},
{
"input": "2\n2 2\n1 3",
"output": "-1"
},
{
"input": "3\n1 2 3\n1 1 4",
"output": "-1"
},
{
"input": "4\n3 4 4 4\n3 3 4 4",
"output": "-1"
}
] | 1,521,811,745 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 77 | 7,065,600 | from sys import stdin
n = int(stdin.readline().rstrip())
diff = [0, 0, 0, 0, 0]
for x in stdin.readline().rstrip().split(' '):
diff[int(x) -1] += 1
for x in stdin.readline().rstrip().split(' '):
diff[int(x) -1] -= 1
result = 0
for k in diff:
if (k % 2 == 1):
print(-1)
break
else:
if (k > 0):
result +=k
print(result//2)
| Title: Pupils Redistribution
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland each high school student is characterized by academic performance — integer value between 1 and 5.
In high school 0xFF there are two groups of pupils: the group *A* and the group *B*. Each group consists of exactly *n* students. An academic performance of each student is known — integer value between 1 and 5.
The school director wants to redistribute students between groups so that each of the two groups has the same number of students whose academic performance is equal to 1, the same number of students whose academic performance is 2 and so on. In other words, the purpose of the school director is to change the composition of groups, so that for each value of academic performance the numbers of students in both groups are equal.
To achieve this, there is a plan to produce a series of exchanges of students between groups. During the single exchange the director selects one student from the class *A* and one student of class *B*. After that, they both change their groups.
Print the least number of exchanges, in order to achieve the desired equal numbers of students for each academic performance.
Input Specification:
The first line of the input contains integer number *n* (1<=≤<=*n*<=≤<=100) — number of students in both groups.
The second line contains sequence of integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=5), where *a**i* is academic performance of the *i*-th student of the group *A*.
The third line contains sequence of integer numbers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=5), where *b**i* is academic performance of the *i*-th student of the group *B*.
Output Specification:
Print the required minimum number of exchanges or -1, if the desired distribution of students can not be obtained.
Demo Input:
['4\n5 4 4 4\n5 5 4 5\n', '6\n1 1 1 1 1 1\n5 5 5 5 5 5\n', '1\n5\n3\n', '9\n3 2 5 5 2 3 3 3 2\n4 1 4 1 1 2 4 4 1\n']
Demo Output:
['1\n', '3\n', '-1\n', '4\n']
Note:
none | ```python
from sys import stdin
n = int(stdin.readline().rstrip())
diff = [0, 0, 0, 0, 0]
for x in stdin.readline().rstrip().split(' '):
diff[int(x) -1] += 1
for x in stdin.readline().rstrip().split(' '):
diff[int(x) -1] -= 1
result = 0
for k in diff:
if (k % 2 == 1):
print(-1)
break
else:
if (k > 0):
result +=k
print(result//2)
``` | 0 |
|
121 | C | Lucky Permutation | PROGRAMMING | 1,900 | [
"brute force",
"combinatorics",
"number theory"
] | null | null | Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
One day Petya dreamt of a lexicographically *k*-th permutation of integers from 1 to *n*. Determine how many lucky numbers in the permutation are located on the positions whose indexes are also lucky numbers. | The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109) — the number of elements in the permutation and the lexicographical number of the permutation. | If the *k*-th permutation of numbers from 1 to *n* does not exist, print the single number "-1" (without the quotes). Otherwise, print the answer to the problem: the number of such indexes *i*, that *i* and *a**i* are both lucky numbers. | [
"7 4\n",
"4 7\n"
] | [
"1\n",
"1\n"
] | A permutation is an ordered set of *n* elements, where each integer from 1 to *n* occurs exactly once. The element of permutation in position with index *i* is denoted as *a*<sub class="lower-index">*i*</sub> (1 ≤ *i* ≤ *n*). Permutation *a* is lexicographically smaller that permutation *b* if there is such a *i* (1 ≤ *i* ≤ *n*), that *a*<sub class="lower-index">*i*</sub> < *b*<sub class="lower-index">*i*</sub>, and for any *j* (1 ≤ *j* < *i*) *a*<sub class="lower-index">*j*</sub> = *b*<sub class="lower-index">*j*</sub>. Let's make a list of all possible permutations of *n* elements and sort it in the order of lexicographical increasing. Then the lexicographically *k*-th permutation is the *k*-th element of this list of permutations.
In the first sample the permutation looks like that:
1 2 3 4 6 7 5
The only suitable position is 4.
In the second sample the permutation looks like that:
2 1 3 4
The only suitable position is 4. | 1,500 | [
{
"input": "7 4",
"output": "1"
},
{
"input": "4 7",
"output": "1"
},
{
"input": "7 1",
"output": "2"
},
{
"input": "7 5040",
"output": "1"
},
{
"input": "10 1023",
"output": "0"
},
{
"input": "7 7477",
"output": "-1"
},
{
"input": "10 10000",
"output": "1"
},
{
"input": "3 7",
"output": "-1"
},
{
"input": "27 1",
"output": "2"
},
{
"input": "40 8544",
"output": "2"
},
{
"input": "47 1",
"output": "4"
},
{
"input": "47 8547744",
"output": "3"
},
{
"input": "50 1000000000",
"output": "4"
},
{
"input": "64 87",
"output": "4"
},
{
"input": "98 854555",
"output": "6"
},
{
"input": "100 1",
"output": "6"
},
{
"input": "9985 5888454",
"output": "30"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "2 1000000000",
"output": "-1"
},
{
"input": "10 1000000000",
"output": "-1"
},
{
"input": "20 1000000000",
"output": "2"
},
{
"input": "777777 1",
"output": "126"
},
{
"input": "777777 2",
"output": "125"
},
{
"input": "777474 10000",
"output": "120"
},
{
"input": "1000000000 1",
"output": "1022"
},
{
"input": "777777777 5",
"output": "1021"
},
{
"input": "777777777 1",
"output": "1022"
},
{
"input": "777477774 1",
"output": "989"
},
{
"input": "444747744 1000000000",
"output": "554"
},
{
"input": "475 88555458",
"output": "8"
},
{
"input": "12 855448",
"output": "1"
},
{
"input": "20 1000000000",
"output": "2"
},
{
"input": "47 99998544",
"output": "2"
},
{
"input": "49 1000000000",
"output": "2"
},
{
"input": "854459 95554455",
"output": "126"
},
{
"input": "77777779 1000000000",
"output": "508"
},
{
"input": "77 47",
"output": "5"
},
{
"input": "6999 85488877",
"output": "22"
},
{
"input": "7479 58884598",
"output": "24"
},
{
"input": "1000000000 1000000000",
"output": "1022"
},
{
"input": "7 1000",
"output": "0"
},
{
"input": "7 124",
"output": "1"
},
{
"input": "7 2048",
"output": "1"
},
{
"input": "7 3001",
"output": "1"
},
{
"input": "7 127",
"output": "1"
},
{
"input": "7 980",
"output": "1"
},
{
"input": "7 5000",
"output": "0"
},
{
"input": "7 4095",
"output": "2"
},
{
"input": "7 3856",
"output": "0"
},
{
"input": "7 5032",
"output": "0"
},
{
"input": "7 4999",
"output": "0"
},
{
"input": "2 3",
"output": "-1"
},
{
"input": "2 4",
"output": "-1"
},
{
"input": "7 985",
"output": "1"
},
{
"input": "4 25",
"output": "-1"
},
{
"input": "6 121",
"output": "1"
},
{
"input": "11 39916801",
"output": "-1"
},
{
"input": "29 1000000000",
"output": "2"
},
{
"input": "10 4589",
"output": "1"
},
{
"input": "10 100000",
"output": "1"
},
{
"input": "10 98564",
"output": "1"
},
{
"input": "10 1",
"output": "2"
},
{
"input": "10 100000009",
"output": "-1"
}
] | 1,688,546,575 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 2,000 | 0 | from math import factorial
from itertools import permutations, islice
# Function to check if a number is lucky
def is_lucky(n):
return all(digit in '47' for digit in str(n))
# Function to generate the kth permutation of the sequence from 1 to n
def kth_permutation(n, k):
# Check if kth permutation is possible
if k > factorial(n):
return -1
# Compute the kth permutation
# We use islice to efficiently get the kth permutation
sequence = range(1, n + 1)
perm_generator = permutations(sequence)
kth_perm = next(islice(perm_generator, k - 1, k), None)
return kth_perm
# The main function to solve the problem
def count_lucky(n, k):
permutation = kth_permutation(n, k)
# Check if permutation exists
if permutation == -1:
return -1
count = 0
for i, num in enumerate(permutation, start=1):
if is_lucky(i) and is_lucky(num):
count += 1
return count
# Get inputs and print the result
n, k = map(int, input().split())
print(count_lucky(n, k)) | Title: Lucky Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
One day Petya dreamt of a lexicographically *k*-th permutation of integers from 1 to *n*. Determine how many lucky numbers in the permutation are located on the positions whose indexes are also lucky numbers.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109) — the number of elements in the permutation and the lexicographical number of the permutation.
Output Specification:
If the *k*-th permutation of numbers from 1 to *n* does not exist, print the single number "-1" (without the quotes). Otherwise, print the answer to the problem: the number of such indexes *i*, that *i* and *a**i* are both lucky numbers.
Demo Input:
['7 4\n', '4 7\n']
Demo Output:
['1\n', '1\n']
Note:
A permutation is an ordered set of *n* elements, where each integer from 1 to *n* occurs exactly once. The element of permutation in position with index *i* is denoted as *a*<sub class="lower-index">*i*</sub> (1 ≤ *i* ≤ *n*). Permutation *a* is lexicographically smaller that permutation *b* if there is such a *i* (1 ≤ *i* ≤ *n*), that *a*<sub class="lower-index">*i*</sub> < *b*<sub class="lower-index">*i*</sub>, and for any *j* (1 ≤ *j* < *i*) *a*<sub class="lower-index">*j*</sub> = *b*<sub class="lower-index">*j*</sub>. Let's make a list of all possible permutations of *n* elements and sort it in the order of lexicographical increasing. Then the lexicographically *k*-th permutation is the *k*-th element of this list of permutations.
In the first sample the permutation looks like that:
1 2 3 4 6 7 5
The only suitable position is 4.
In the second sample the permutation looks like that:
2 1 3 4
The only suitable position is 4. | ```python
from math import factorial
from itertools import permutations, islice
# Function to check if a number is lucky
def is_lucky(n):
return all(digit in '47' for digit in str(n))
# Function to generate the kth permutation of the sequence from 1 to n
def kth_permutation(n, k):
# Check if kth permutation is possible
if k > factorial(n):
return -1
# Compute the kth permutation
# We use islice to efficiently get the kth permutation
sequence = range(1, n + 1)
perm_generator = permutations(sequence)
kth_perm = next(islice(perm_generator, k - 1, k), None)
return kth_perm
# The main function to solve the problem
def count_lucky(n, k):
permutation = kth_permutation(n, k)
# Check if permutation exists
if permutation == -1:
return -1
count = 0
for i, num in enumerate(permutation, start=1):
if is_lucky(i) and is_lucky(num):
count += 1
return count
# Get inputs and print the result
n, k = map(int, input().split())
print(count_lucky(n, k))
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | In the spirit of the holidays, Saitama has given Genos two grid paths of length *n* (a weird gift even by Saitama's standards). A grid path is an ordered sequence of neighbouring squares in an infinite grid. Two squares are neighbouring if they share a side.
One example of a grid path is (0,<=0)<=→<=(0,<=1)<=→<=(0,<=2)<=→<=(1,<=2)<=→<=(1,<=1)<=→<=(0,<=1)<=→<=(<=-<=1,<=1). Note that squares in this sequence might be repeated, i.e. path has self intersections.
Movement within a grid path is restricted to adjacent squares within the sequence. That is, from the *i*-th square, one can only move to the (*i*<=-<=1)-th or (*i*<=+<=1)-th squares of this path. Note that there is only a single valid move from the first and last squares of a grid path. Also note, that even if there is some *j*-th square of the path that coincides with the *i*-th square, only moves to (*i*<=-<=1)-th and (*i*<=+<=1)-th squares are available. For example, from the second square in the above sequence, one can only move to either the first or third squares.
To ensure that movement is not ambiguous, the two grid paths will not have an alternating sequence of three squares. For example, a contiguous subsequence (0,<=0)<=→<=(0,<=1)<=→<=(0,<=0) cannot occur in a valid grid path.
One marble is placed on the first square of each grid path. Genos wants to get both marbles to the last square of each grid path. However, there is a catch. Whenever he moves one marble, the other marble will copy its movement if possible. For instance, if one marble moves east, then the other marble will try and move east as well. By try, we mean if moving east is a valid move, then the marble will move east.
Moving north increases the second coordinate by 1, while moving south decreases it by 1. Similarly, moving east increases first coordinate by 1, while moving west decreases it.
Given these two valid grid paths, Genos wants to know if it is possible to move both marbles to the ends of their respective paths. That is, if it is possible to move the marbles such that both marbles rest on the last square of their respective paths. | The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1<=000<=000) — the length of the paths.
The second line of the input contains a string consisting of *n*<=-<=1 characters (each of which is either 'N', 'E', 'S', or 'W') — the first grid path. The characters can be thought of as the sequence of moves needed to traverse the grid path. For example, the example path in the problem statement can be expressed by the string "NNESWW".
The third line of the input contains a string of *n*<=-<=1 characters (each of which is either 'N', 'E', 'S', or 'W') — the second grid path. | Print "YES" (without quotes) if it is possible for both marbles to be at the end position at the same time. Print "NO" (without quotes) otherwise. In both cases, the answer is case-insensitive. | [
"7\nNNESWW\nSWSWSW\n",
"3\nNN\nSS\n"
] | [
"YES\n",
"NO\n"
] | In the first sample, the first grid path is the one described in the statement. Moreover, the following sequence of moves will get both marbles to the end: NNESWWSWSW.
In the second sample, no sequence of moves can get both marbles to the end. | 0 | [
{
"input": "7\nNNESWW\nSWSWSW",
"output": "YES"
},
{
"input": "3\nNN\nSS",
"output": "NO"
},
{
"input": "3\nES\nNW",
"output": "NO"
},
{
"input": "5\nWSSE\nWNNE",
"output": "NO"
},
{
"input": "2\nE\nE",
"output": "YES"
},
{
"input": "2\nW\nS",
"output": "YES"
},
{
"input": "2\nS\nN",
"output": "NO"
},
{
"input": "100\nWNWWSWWSESWWWSSSSWSSEENWNWWWWNNENESWSESSENEENNWWWWWSSWSWSENESWNEENESWWNNEESESWSEEENWWNWNNWWNNWWWWSW\nEESEESSENWNWWWNWWNWWNWWSWNNWNWNWSWNNEENWSWNNESWSWNWSESENWSWSWWWWNNEESSSWSSESWWSSWSSWSWNEEESWWSSSSEN",
"output": "NO"
},
{
"input": "200\nNESENEESEESWWWNWWSWSWNWNNWNNESWSWNNWNWNENESENNESSWSESWWSSSEEEESSENNNESSWWSSSSESWSWWNNEESSWWNNWSWSSWWNWNNEENNENWWNESSSENWNESWNESWNESEESSWNESSSSSESESSWNNENENESSWWNNWWSWWNESEENWWWWNWWNWWNENESESSWWSWWSES\nNWNESESSENNNESWNWWSWWWNWSESSSWWNWWNNWSENWSWNENNNWWSWWSWNNNESWWWSSESSWWWSSENWSENWWNENESESWNENNESWNWNNENNWWWSENWSWSSSENNWWNEESENNESEESSEESWWWWWWNWNNNESESWSSEEEESWNENWSESEEENWNNWWNWNNNNWWSSWNEENENEEEEEE",
"output": "YES"
},
{
"input": "11\nWWNNNNWNWN\nENWSWWSSEE",
"output": "YES"
},
{
"input": "12\nWNNWSWWSSSE\nNESWNNNWSSS",
"output": "YES"
}
] | 1,452,514,620 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 13 | 2,000 | 6,348,800 | def reverse(s):
res = ''
for i in range(n - 1):
if s[i] == 'W': res += 'E'
elif s[i] == 'E': res += 'W'
elif s[i] == 'N': res += 'S'
elif s[i] == 'S': res += 'N'
return res
n = int(input())
s1 = input()
s2 = input()
s2 = reverse(s2)[::-1]
f = 1
for i in range(1, n):
if s2[0:i] == s1[n - i - 1:n - 1]:
f = 0
break
print ( 'YES' if f else 'NO') | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the spirit of the holidays, Saitama has given Genos two grid paths of length *n* (a weird gift even by Saitama's standards). A grid path is an ordered sequence of neighbouring squares in an infinite grid. Two squares are neighbouring if they share a side.
One example of a grid path is (0,<=0)<=→<=(0,<=1)<=→<=(0,<=2)<=→<=(1,<=2)<=→<=(1,<=1)<=→<=(0,<=1)<=→<=(<=-<=1,<=1). Note that squares in this sequence might be repeated, i.e. path has self intersections.
Movement within a grid path is restricted to adjacent squares within the sequence. That is, from the *i*-th square, one can only move to the (*i*<=-<=1)-th or (*i*<=+<=1)-th squares of this path. Note that there is only a single valid move from the first and last squares of a grid path. Also note, that even if there is some *j*-th square of the path that coincides with the *i*-th square, only moves to (*i*<=-<=1)-th and (*i*<=+<=1)-th squares are available. For example, from the second square in the above sequence, one can only move to either the first or third squares.
To ensure that movement is not ambiguous, the two grid paths will not have an alternating sequence of three squares. For example, a contiguous subsequence (0,<=0)<=→<=(0,<=1)<=→<=(0,<=0) cannot occur in a valid grid path.
One marble is placed on the first square of each grid path. Genos wants to get both marbles to the last square of each grid path. However, there is a catch. Whenever he moves one marble, the other marble will copy its movement if possible. For instance, if one marble moves east, then the other marble will try and move east as well. By try, we mean if moving east is a valid move, then the marble will move east.
Moving north increases the second coordinate by 1, while moving south decreases it by 1. Similarly, moving east increases first coordinate by 1, while moving west decreases it.
Given these two valid grid paths, Genos wants to know if it is possible to move both marbles to the ends of their respective paths. That is, if it is possible to move the marbles such that both marbles rest on the last square of their respective paths.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=1<=000<=000) — the length of the paths.
The second line of the input contains a string consisting of *n*<=-<=1 characters (each of which is either 'N', 'E', 'S', or 'W') — the first grid path. The characters can be thought of as the sequence of moves needed to traverse the grid path. For example, the example path in the problem statement can be expressed by the string "NNESWW".
The third line of the input contains a string of *n*<=-<=1 characters (each of which is either 'N', 'E', 'S', or 'W') — the second grid path.
Output Specification:
Print "YES" (without quotes) if it is possible for both marbles to be at the end position at the same time. Print "NO" (without quotes) otherwise. In both cases, the answer is case-insensitive.
Demo Input:
['7\nNNESWW\nSWSWSW\n', '3\nNN\nSS\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, the first grid path is the one described in the statement. Moreover, the following sequence of moves will get both marbles to the end: NNESWWSWSW.
In the second sample, no sequence of moves can get both marbles to the end. | ```python
def reverse(s):
res = ''
for i in range(n - 1):
if s[i] == 'W': res += 'E'
elif s[i] == 'E': res += 'W'
elif s[i] == 'N': res += 'S'
elif s[i] == 'S': res += 'N'
return res
n = int(input())
s1 = input()
s2 = input()
s2 = reverse(s2)[::-1]
f = 1
for i in range(1, n):
if s2[0:i] == s1[n - i - 1:n - 1]:
f = 0
break
print ( 'YES' if f else 'NO')
``` | 0 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,675,315,321 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 0 | n = int(input("n: "))
m = int(input("m: "))
a = int(input("a: "))
rows,columns=(0,0)
if m%a == 0:
rows = m/a
else:
rows = (m - m%a)/a + 1
if n%a == 0:
columns = n/a
else:
columns = (n - n%a)/a + 1
print(int(rows*columns)) | Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
n = int(input("n: "))
m = int(input("m: "))
a = int(input("a: "))
rows,columns=(0,0)
if m%a == 0:
rows = m/a
else:
rows = (m - m%a)/a + 1
if n%a == 0:
columns = n/a
else:
columns = (n - n%a)/a + 1
print(int(rows*columns))
``` | -1 |
186 | A | Comparing Strings | PROGRAMMING | 1,100 | [
"implementation",
"strings"
] | null | null | Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not. | The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length. | Print "YES", if the dwarves belong to the same race. Otherwise, print "NO". | [
"ab\nba\n",
"aa\nab\n"
] | [
"YES\n",
"NO\n"
] | - First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b". | 500 | [
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
] | 1,590,424,194 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 16 | 310 | 6,553,600 | a=list(input(""))
b=list(input(""))
if set(a)==set(b) and len(a)==len(b):
i = 0
c = 0
while c < 2:
if a[i] != b[i]:
c += 1
else:
pass
i += 1
if c==2:
print("YES")
else:
print("NO")
else:
print("NO") | Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b". | ```python
a=list(input(""))
b=list(input(""))
if set(a)==set(b) and len(a)==len(b):
i = 0
c = 0
while c < 2:
if a[i] != b[i]:
c += 1
else:
pass
i += 1
if c==2:
print("YES")
else:
print("NO")
else:
print("NO")
``` | 0 |
|
980 | A | Links and Pearls | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | A necklace can be described as a string of links ('-') and pearls ('o'), with the last link or pearl connected to the first one.
You can remove a link or a pearl and insert it between two other existing links or pearls (or between a link and a pearl) on the necklace. This process can be repeated as many times as you like, but you can't throw away any parts.
Can you make the number of links between every two adjacent pearls equal? Two pearls are considered to be adjacent if there is no other pearl between them.
Note that the final necklace should remain as one circular part of the same length as the initial necklace. | The only line of input contains a string $s$ ($3 \leq |s| \leq 100$), representing the necklace, where a dash '-' represents a link and the lowercase English letter 'o' represents a pearl. | Print "YES" if the links and pearls can be rejoined such that the number of links between adjacent pearls is equal. Otherwise print "NO".
You can print each letter in any case (upper or lower). | [
"-o-o--",
"-o---\n",
"-o---o-\n",
"ooo\n"
] | [
"YES",
"YES",
"NO",
"YES\n"
] | none | 500 | [
{
"input": "-o-o--",
"output": "YES"
},
{
"input": "-o---",
"output": "YES"
},
{
"input": "-o---o-",
"output": "NO"
},
{
"input": "ooo",
"output": "YES"
},
{
"input": "---",
"output": "YES"
},
{
"input": "--o-o-----o----o--oo-o-----ooo-oo---o--",
"output": "YES"
},
{
"input": "-o--o-oo---o-o-o--o-o----oo------oo-----o----o-o-o--oo-o--o---o--o----------o---o-o-oo---o--o-oo-o--",
"output": "NO"
},
{
"input": "-ooo--",
"output": "YES"
},
{
"input": "---o--",
"output": "YES"
},
{
"input": "oo-ooo",
"output": "NO"
},
{
"input": "------o-o--o-----o--",
"output": "YES"
},
{
"input": "--o---o----------o----o----------o--o-o-----o-oo---oo--oo---o-------------oo-----o-------------o---o",
"output": "YES"
},
{
"input": "----------------------------------------------------------------------------------------------------",
"output": "YES"
},
{
"input": "-oo-oo------",
"output": "YES"
},
{
"input": "---------------------------------o----------------------------oo------------------------------------",
"output": "NO"
},
{
"input": "oo--o--o--------oo----------------o-----------o----o-----o----------o---o---o-----o---------ooo---",
"output": "NO"
},
{
"input": "--o---oooo--o-o--o-----o----ooooo--o-oo--o------oooo--------------ooo-o-o----",
"output": "NO"
},
{
"input": "-----------------------------o--o-o-------",
"output": "YES"
},
{
"input": "o-oo-o--oo----o-o----------o---o--o----o----o---oo-ooo-o--o-",
"output": "YES"
},
{
"input": "oooooooooo-ooo-oooooo-ooooooooooooooo--o-o-oooooooooooooo-oooooooooooooo",
"output": "NO"
},
{
"input": "-----------------o-o--oo------o--------o---o--o----------------oooo-------------ooo-----ooo-----o",
"output": "NO"
},
{
"input": "ooo-ooooooo-oo-ooooooooo-oooooooooooooo-oooo-o-oooooooooo--oooooooooooo-oooooooooo-ooooooo",
"output": "NO"
},
{
"input": "oo-o-ooooo---oo---o-oo---o--o-ooo-o---o-oo---oo---oooo---o---o-oo-oo-o-ooo----ooo--oo--o--oo-o-oo",
"output": "NO"
},
{
"input": "-----o-----oo-o-o-o-o----o---------oo---ooo-------------o----o---o-o",
"output": "YES"
},
{
"input": "oo--o-o-o----o-oooo-ooooo---o-oo--o-o--ooo--o--oooo--oo----o----o-o-oooo---o-oooo--ooo-o-o----oo---",
"output": "NO"
},
{
"input": "------oo----o----o-oo-o--------o-----oo-----------------------o------------o-o----oo---------",
"output": "NO"
},
{
"input": "-o--o--------o--o------o---o-o----------o-------o-o-o-------oo----oo------o------oo--o--",
"output": "NO"
},
{
"input": "------------------o----------------------------------o-o-------------",
"output": "YES"
},
{
"input": "-------------o----ooo-----o-o-------------ooo-----------ooo------o----oo---",
"output": "YES"
},
{
"input": "-------o--------------------o--o---------------o---o--o-----",
"output": "YES"
},
{
"input": "------------------------o------------o-----o----------------",
"output": "YES"
},
{
"input": "------oo----------o------o-----o---------o------------o----o--o",
"output": "YES"
},
{
"input": "------------o------------------o-----------------------o-----------o",
"output": "YES"
},
{
"input": "o---o---------------",
"output": "YES"
},
{
"input": "----------------------o---o----o---o-----------o-o-----o",
"output": "YES"
},
{
"input": "----------------------------------------------------------------------o-o---------------------",
"output": "YES"
},
{
"input": "----o---o-------------------------",
"output": "YES"
},
{
"input": "o----------------------oo----",
"output": "NO"
},
{
"input": "-o-o--o-o--o-----o-----o-o--o-o---oooo-o",
"output": "NO"
},
{
"input": "-o-ooo-o--o----o--o-o-oo-----------o-o-",
"output": "YES"
},
{
"input": "o-------o-------o-------------",
"output": "YES"
},
{
"input": "oo----------------------o--------------o--------------o-----",
"output": "YES"
},
{
"input": "-----------------------------------o---------------------o--------------------------",
"output": "YES"
},
{
"input": "--o--o----o-o---o--o----o-o--oo-----o-oo--o---o---ooo-o--",
"output": "YES"
},
{
"input": "---------------o-o----",
"output": "YES"
},
{
"input": "o------ooo--o-o-oo--o------o----ooo-----o-----o-----o-ooo-o---o----oo",
"output": "YES"
},
{
"input": "----o----o",
"output": "YES"
},
{
"input": "o--o--o--o--o--o--o--o--o--o--o--o--",
"output": "YES"
},
{
"input": "o---o---o---o---o----o----o----o---o---o---o",
"output": "YES"
},
{
"input": "o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-",
"output": "YES"
},
{
"input": "-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o-o",
"output": "YES"
},
{
"input": "o----------o----------o----------o----------o----------o----------o----------o----------o----------o",
"output": "YES"
},
{
"input": "o---------o---------o---------o---------o---------o---------o---------o---------o",
"output": "YES"
},
{
"input": "--------o--------o--------o--------o--------o--------o--------o--------o--------",
"output": "YES"
},
{
"input": "o---o----",
"output": "NO"
},
{
"input": "---o----o",
"output": "NO"
},
{
"input": "-o-",
"output": "YES"
},
{
"input": "------oooo",
"output": "NO"
},
{
"input": "oo--",
"output": "YES"
},
{
"input": "---o",
"output": "YES"
},
{
"input": "ooo-",
"output": "NO"
},
{
"input": "oooooooo----------",
"output": "NO"
},
{
"input": "oooo--",
"output": "NO"
},
{
"input": "o-ooooo",
"output": "NO"
},
{
"input": "-oo",
"output": "NO"
},
{
"input": "ooooo-",
"output": "NO"
},
{
"input": "ooo---------",
"output": "YES"
},
{
"input": "oo-",
"output": "NO"
},
{
"input": "---ooo",
"output": "YES"
}
] | 1,691,342,727 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 4 | 31 | 0 | s=input()
p=0
n=0
for i in range (len(s)):
if s[i]=='o':
p+=1
else:
n+=1
ans=n%p
if n%p==0:
print('Yes')
else:
print('No')
| Title: Links and Pearls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A necklace can be described as a string of links ('-') and pearls ('o'), with the last link or pearl connected to the first one.
You can remove a link or a pearl and insert it between two other existing links or pearls (or between a link and a pearl) on the necklace. This process can be repeated as many times as you like, but you can't throw away any parts.
Can you make the number of links between every two adjacent pearls equal? Two pearls are considered to be adjacent if there is no other pearl between them.
Note that the final necklace should remain as one circular part of the same length as the initial necklace.
Input Specification:
The only line of input contains a string $s$ ($3 \leq |s| \leq 100$), representing the necklace, where a dash '-' represents a link and the lowercase English letter 'o' represents a pearl.
Output Specification:
Print "YES" if the links and pearls can be rejoined such that the number of links between adjacent pearls is equal. Otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['-o-o--', '-o---\n', '-o---o-\n', 'ooo\n']
Demo Output:
['YES', 'YES', 'NO', 'YES\n']
Note:
none | ```python
s=input()
p=0
n=0
for i in range (len(s)):
if s[i]=='o':
p+=1
else:
n+=1
ans=n%p
if n%p==0:
print('Yes')
else:
print('No')
``` | -1 |
|
1,005 | D | Polycarp and Div 3 | PROGRAMMING | 1,500 | [
"dp",
"greedy",
"number theory"
] | null | null | Polycarp likes numbers that are divisible by 3.
He has a huge number $s$. Polycarp wants to cut from it the maximum number of numbers that are divisible by $3$. To do this, he makes an arbitrary number of vertical cuts between pairs of adjacent digits. As a result, after $m$ such cuts, there will be $m+1$ parts in total. Polycarp analyzes each of the obtained numbers and finds the number of those that are divisible by $3$.
For example, if the original number is $s=3121$, then Polycarp can cut it into three parts with two cuts: $3|1|21$. As a result, he will get two numbers that are divisible by $3$.
Polycarp can make an arbitrary number of vertical cuts, where each cut is made between a pair of adjacent digits. The resulting numbers cannot contain extra leading zeroes (that is, the number can begin with 0 if and only if this number is exactly one character '0'). For example, 007, 01 and 00099 are not valid numbers, but 90, 0 and 10001 are valid.
What is the maximum number of numbers divisible by $3$ that Polycarp can obtain? | The first line of the input contains a positive integer $s$. The number of digits of the number $s$ is between $1$ and $2\cdot10^5$, inclusive. The first (leftmost) digit is not equal to 0. | Print the maximum number of numbers divisible by $3$ that Polycarp can get by making vertical cuts in the given number $s$. | [
"3121\n",
"6\n",
"1000000000000000000000000000000000\n",
"201920181\n"
] | [
"2\n",
"1\n",
"33\n",
"4\n"
] | In the first example, an example set of optimal cuts on the number is 3|1|21.
In the second example, you do not need to make any cuts. The specified number 6 forms one number that is divisible by $3$.
In the third example, cuts must be made between each pair of digits. As a result, Polycarp gets one digit 1 and $33$ digits 0. Each of the $33$ digits 0 forms a number that is divisible by $3$.
In the fourth example, an example set of optimal cuts is 2|0|1|9|201|81. The numbers $0$, $9$, $201$ and $81$ are divisible by $3$. | 0 | [
{
"input": "3121",
"output": "2"
},
{
"input": "6",
"output": "1"
},
{
"input": "1000000000000000000000000000000000",
"output": "33"
},
{
"input": "201920181",
"output": "4"
},
{
"input": "4",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "31",
"output": "1"
},
{
"input": "14139582796",
"output": "6"
},
{
"input": "1670000",
"output": "5"
},
{
"input": "604500",
"output": "5"
},
{
"input": "40041",
"output": "2"
},
{
"input": "10000170",
"output": "5"
}
] | 1,685,649,876 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 701 | 42,905,600 | from functools import lru_cache
import sys
input = sys.stdin.readline
num = input().strip()
n = len(num)
# @lru_cache(None)
# def dp(i, sum_under_mod):
# if i >= n:
# return 0
# sum_under_mod = ( sum_under_mod + int(num[i]) ) % 3
# return max(
# dp(i + 1, sum_under_mod),
# dp(i + 1, 0) + (sum_under_mod % 3 == 0)
# )
# print(dp(0, 0))
dp = [[0 for _ in range(3)] for _ in range(n + 1)]
for i in range(n - 1, -1, -1):
for j in range(2, -1, -1):
hold = (j + int(num[i])) % 3
dp[i][j] = max(dp[i + 1][hold], dp[i + 1][0] + (hold % 3 == 0))
print(dp[0][0])
# print(dp)
# 3 1 2 1
# 6 | Title: Polycarp and Div 3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp likes numbers that are divisible by 3.
He has a huge number $s$. Polycarp wants to cut from it the maximum number of numbers that are divisible by $3$. To do this, he makes an arbitrary number of vertical cuts between pairs of adjacent digits. As a result, after $m$ such cuts, there will be $m+1$ parts in total. Polycarp analyzes each of the obtained numbers and finds the number of those that are divisible by $3$.
For example, if the original number is $s=3121$, then Polycarp can cut it into three parts with two cuts: $3|1|21$. As a result, he will get two numbers that are divisible by $3$.
Polycarp can make an arbitrary number of vertical cuts, where each cut is made between a pair of adjacent digits. The resulting numbers cannot contain extra leading zeroes (that is, the number can begin with 0 if and only if this number is exactly one character '0'). For example, 007, 01 and 00099 are not valid numbers, but 90, 0 and 10001 are valid.
What is the maximum number of numbers divisible by $3$ that Polycarp can obtain?
Input Specification:
The first line of the input contains a positive integer $s$. The number of digits of the number $s$ is between $1$ and $2\cdot10^5$, inclusive. The first (leftmost) digit is not equal to 0.
Output Specification:
Print the maximum number of numbers divisible by $3$ that Polycarp can get by making vertical cuts in the given number $s$.
Demo Input:
['3121\n', '6\n', '1000000000000000000000000000000000\n', '201920181\n']
Demo Output:
['2\n', '1\n', '33\n', '4\n']
Note:
In the first example, an example set of optimal cuts on the number is 3|1|21.
In the second example, you do not need to make any cuts. The specified number 6 forms one number that is divisible by $3$.
In the third example, cuts must be made between each pair of digits. As a result, Polycarp gets one digit 1 and $33$ digits 0. Each of the $33$ digits 0 forms a number that is divisible by $3$.
In the fourth example, an example set of optimal cuts is 2|0|1|9|201|81. The numbers $0$, $9$, $201$ and $81$ are divisible by $3$. | ```python
from functools import lru_cache
import sys
input = sys.stdin.readline
num = input().strip()
n = len(num)
# @lru_cache(None)
# def dp(i, sum_under_mod):
# if i >= n:
# return 0
# sum_under_mod = ( sum_under_mod + int(num[i]) ) % 3
# return max(
# dp(i + 1, sum_under_mod),
# dp(i + 1, 0) + (sum_under_mod % 3 == 0)
# )
# print(dp(0, 0))
dp = [[0 for _ in range(3)] for _ in range(n + 1)]
for i in range(n - 1, -1, -1):
for j in range(2, -1, -1):
hold = (j + int(num[i])) % 3
dp[i][j] = max(dp[i + 1][hold], dp[i + 1][0] + (hold % 3 == 0))
print(dp[0][0])
# print(dp)
# 3 1 2 1
# 6
``` | 3 |
|
466 | A | Cheap Travel | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides? | The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket. | Print a single integer — the minimum sum in rubles that Ann will need to spend. | [
"6 2 1 2\n",
"5 2 2 3\n"
] | [
"6\n",
"8\n"
] | In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets. | 500 | [
{
"input": "6 2 1 2",
"output": "6"
},
{
"input": "5 2 2 3",
"output": "8"
},
{
"input": "10 3 5 1",
"output": "4"
},
{
"input": "1000 1 1000 1000",
"output": "1000000"
},
{
"input": "1000 3 1000 1000",
"output": "334000"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10 2 1 1",
"output": "5"
},
{
"input": "1 1000 1 2",
"output": "1"
},
{
"input": "1 1000 3 2",
"output": "2"
},
{
"input": "10 3 1 2",
"output": "7"
},
{
"input": "995 1 2 1",
"output": "995"
},
{
"input": "556 2 16 15",
"output": "4170"
},
{
"input": "477 2 16 14",
"output": "3346"
},
{
"input": "101 110 1 100",
"output": "100"
},
{
"input": "9 3 3 10",
"output": "27"
},
{
"input": "100 8 10 1",
"output": "13"
},
{
"input": "6 4 1 3",
"output": "5"
},
{
"input": "8 5 2 8",
"output": "14"
},
{
"input": "1000 2 1 1000",
"output": "1000"
}
] | 1,683,898,385 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 0 | n = int(input())
m = int(input())
a = int(input())
b = int(input())
if n%m == 0:
x = n-m
y = x*a
z = y+b
print(z)
else:
t = n%m
q = t*a
q = q+(b*m)
print(q) | Title: Cheap Travel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ann has recently started commuting by subway. We know that a one ride subway ticket costs *a* rubles. Besides, Ann found out that she can buy a special ticket for *m* rides (she can buy it several times). It costs *b* rubles. Ann did the math; she will need to use subway *n* times. Help Ann, tell her what is the minimum sum of money she will have to spend to make *n* rides?
Input Specification:
The single line contains four space-separated integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*,<=*a*,<=*b*<=≤<=1000) — the number of rides Ann has planned, the number of rides covered by the *m* ride ticket, the price of a one ride ticket and the price of an *m* ride ticket.
Output Specification:
Print a single integer — the minimum sum in rubles that Ann will need to spend.
Demo Input:
['6 2 1 2\n', '5 2 2 3\n']
Demo Output:
['6\n', '8\n']
Note:
In the first sample one of the optimal solutions is: each time buy a one ride ticket. There are other optimal solutions. For example, buy three *m* ride tickets. | ```python
n = int(input())
m = int(input())
a = int(input())
b = int(input())
if n%m == 0:
x = n-m
y = x*a
z = y+b
print(z)
else:
t = n%m
q = t*a
q = q+(b*m)
print(q)
``` | -1 |
|
899 | C | Dividing the numbers | PROGRAMMING | 1,300 | [
"constructive algorithms",
"graphs",
"math"
] | null | null | Petya has *n* integers: 1,<=2,<=3,<=...,<=*n*. He wants to split these integers in two non-empty groups in such a way that the absolute difference of sums of integers in each group is as small as possible.
Help Petya to split the integers. Each of *n* integers should be exactly in one group. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of integers Petya has. | Print the smallest possible absolute difference in the first line.
In the second line print the size of the first group, followed by the integers in that group. You can print these integers in arbitrary order. If there are multiple answers, print any of them. | [
"4\n",
"2\n"
] | [
"0\n2 1 4 \n",
"1\n1 1 \n"
] | In the first example you have to put integers 1 and 4 in the first group, and 2 and 3 in the second. This way the sum in each group is 5, and the absolute difference is 0.
In the second example there are only two integers, and since both groups should be non-empty, you have to put one integer in the first group and one in the second. This way the absolute difference of sums of integers in each group is 1. | 1,500 | [
{
"input": "4",
"output": "0\n2 1 4 "
},
{
"input": "2",
"output": "1\n1 1 "
},
{
"input": "3",
"output": "0\n1\n3 "
},
{
"input": "5",
"output": "1\n3\n1 2 5 "
},
{
"input": "59998",
"output": "1\n29999 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "60000",
"output": "0\n30000 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59991",
"output": "0\n29995\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59989",
"output": "1\n29995\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "6",
"output": "1\n3 1 4 5 "
},
{
"input": "7",
"output": "0\n3\n1 6 7 "
},
{
"input": "8",
"output": "0\n4 1 4 5 8 "
},
{
"input": "9",
"output": "1\n5\n1 2 3 8 9 "
},
{
"input": "10",
"output": "1\n5 1 4 5 8 9 "
},
{
"input": "11",
"output": "0\n5\n1 2 9 10 11 "
},
{
"input": "12",
"output": "0\n6 1 4 5 8 9 12 "
},
{
"input": "13",
"output": "1\n7\n1 2 3 4 11 12 13 "
},
{
"input": "14",
"output": "1\n7 1 4 5 8 9 12 13 "
},
{
"input": "15",
"output": "0\n7\n1 2 3 12 13 14 15 "
},
{
"input": "16",
"output": "0\n8 1 4 5 8 9 12 13 16 "
},
{
"input": "17",
"output": "1\n9\n1 2 3 4 5 14 15 16 17 "
},
{
"input": "18",
"output": "1\n9 1 4 5 8 9 12 13 16 17 "
},
{
"input": "19",
"output": "0\n9\n1 2 3 4 15 16 17 18 19 "
},
{
"input": "20",
"output": "0\n10 1 4 5 8 9 12 13 16 17 20 "
},
{
"input": "21",
"output": "1\n11\n1 2 3 4 5 6 17 18 19 20 21 "
},
{
"input": "22",
"output": "1\n11 1 4 5 8 9 12 13 16 17 20 21 "
},
{
"input": "23",
"output": "0\n11\n1 2 3 4 5 18 19 20 21 22 23 "
},
{
"input": "24",
"output": "0\n12 1 4 5 8 9 12 13 16 17 20 21 24 "
},
{
"input": "59999",
"output": "0\n29999\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59997",
"output": "1\n29999\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59996",
"output": "0\n29998 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59995",
"output": "0\n29997\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59994",
"output": "1\n29997 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59993",
"output": "1\n29997\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "59992",
"output": "0\n29996 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "59990",
"output": "1\n29995 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "100",
"output": "0\n50 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 "
},
{
"input": "1000",
"output": "0\n500 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 28..."
},
{
"input": "10001",
"output": "1\n5001\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "103",
"output": "0\n51\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 "
},
{
"input": "1002",
"output": "1\n501 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 28..."
},
{
"input": "31724",
"output": "0\n15862 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "2032",
"output": "0\n1016 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "42620",
"output": "0\n21310 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "18076",
"output": "0\n9038 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "53520",
"output": "0\n26760 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "37193",
"output": "1\n18597\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "12645",
"output": "1\n6323\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "53237",
"output": "1\n26619\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "28693",
"output": "1\n14347\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "4145",
"output": "1\n2073\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "36042",
"output": "1\n18021 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "16646",
"output": "1\n8323 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "57238",
"output": "1\n28619 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "27542",
"output": "1\n13771 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 ..."
},
{
"input": "8146",
"output": "1\n4073 1 4 5 8 9 12 13 16 17 20 21 24 25 28 29 32 33 36 37 40 41 44 45 48 49 52 53 56 57 60 61 64 65 68 69 72 73 76 77 80 81 84 85 88 89 92 93 96 97 100 101 104 105 108 109 112 113 116 117 120 121 124 125 128 129 132 133 136 137 140 141 144 145 148 149 152 153 156 157 160 161 164 165 168 169 172 173 176 177 180 181 184 185 188 189 192 193 196 197 200 201 204 205 208 209 212 213 216 217 220 221 224 225 228 229 232 233 236 237 240 241 244 245 248 249 252 253 256 257 260 261 264 265 268 269 272 273 276 277 2..."
},
{
"input": "46659",
"output": "0\n23329\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "27259",
"output": "0\n13629\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "2715",
"output": "0\n1357\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "38159",
"output": "0\n19079\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "18759",
"output": "0\n9379\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
}
] | 1,610,285,535 | 2,147,483,647 | PyPy 3 | OK | TESTS | 60 | 109 | 3,481,600 | n = int(input())
h = n * (n + 1) // 4
used = []
high = n
while h > 0 and high <= h:
h -= high
used.append(high)
high -= 1
if h:
used.append(h)
print(n * (n + 1) // 2 % 2)
print(len(used), *used)
| Title: Dividing the numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya has *n* integers: 1,<=2,<=3,<=...,<=*n*. He wants to split these integers in two non-empty groups in such a way that the absolute difference of sums of integers in each group is as small as possible.
Help Petya to split the integers. Each of *n* integers should be exactly in one group.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of integers Petya has.
Output Specification:
Print the smallest possible absolute difference in the first line.
In the second line print the size of the first group, followed by the integers in that group. You can print these integers in arbitrary order. If there are multiple answers, print any of them.
Demo Input:
['4\n', '2\n']
Demo Output:
['0\n2 1 4 \n', '1\n1 1 \n']
Note:
In the first example you have to put integers 1 and 4 in the first group, and 2 and 3 in the second. This way the sum in each group is 5, and the absolute difference is 0.
In the second example there are only two integers, and since both groups should be non-empty, you have to put one integer in the first group and one in the second. This way the absolute difference of sums of integers in each group is 1. | ```python
n = int(input())
h = n * (n + 1) // 4
used = []
high = n
while h > 0 and high <= h:
h -= high
used.append(high)
high -= 1
if h:
used.append(h)
print(n * (n + 1) // 2 % 2)
print(len(used), *used)
``` | 3 |
|
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,625,020,347 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | teams = {}
for i in range(int(input())):
team = input()
if team in teams:
teams[team]+=1
else:
teams[team] = 1
print(teams)
a = max(teams.values())
for i in teams.keys():
if teams[i] == a:
print(i) | Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
teams = {}
for i in range(int(input())):
team = input()
if team in teams:
teams[team]+=1
else:
teams[team] = 1
print(teams)
a = max(teams.values())
for i in teams.keys():
if teams[i] == a:
print(i)
``` | 0 |
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,689,589,513 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 0 | import numpy as np
l=[]
count = 0
for _ in range(int(input())):
l.append(list(map(int,input().split())))
for i in l:
if i.count(1) >=2:
count+=1
print(count)
| Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
import numpy as np
l=[]
count = 0
for _ in range(int(input())):
l.append(list(map(int,input().split())))
for i in l:
if i.count(1) >=2:
count+=1
print(count)
``` | -1 |
9 | A | Die Roll | PROGRAMMING | 800 | [
"math",
"probabilities"
] | A. Die Roll | 1 | 64 | Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. | The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. | Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». | [
"4 2\n"
] | [
"1/2\n"
] | Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | 0 | [
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,674,733,340 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 36 | 122 | 0 | a,b = map(int, input().split())
n = 6-max([a,b]) + 1
if 6 % n == 0:
print(f"1/{6//n}")
elif n % 2 == 0:
print(f"{n//2}/{6//2}")
else:
print(f"{n}/6")
| Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | ```python
a,b = map(int, input().split())
n = 6-max([a,b]) + 1
if 6 % n == 0:
print(f"1/{6//n}")
elif n % 2 == 0:
print(f"{n//2}/{6//2}")
else:
print(f"{n}/6")
``` | 3.939 |
215 | A | Bicycle Chain | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed. | The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces. | Print the number of "integer" gears with the maximum ratio among all "integer" gears. | [
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] | [
"2\n",
"1\n"
] | In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15. | 500 | [
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,697,726,485 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 8 | 62 | 0 | # 2
# 4 5
# 3
# 12 13 15
n=int(input())
a=list(map(int,input().split()))
m=int(input())
b=list(map(int,input().split()))
freq={}
for i in range(m):
for j in range(n):
if b[i]%a[j]==0:
if b[i]//a[j] in freq:
freq[b[i]//a[j]]+=1
else:
freq[b[i]//a[j]]=1
res=0
print(max(freq.values()))
| Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15. | ```python
# 2
# 4 5
# 3
# 12 13 15
n=int(input())
a=list(map(int,input().split()))
m=int(input())
b=list(map(int,input().split()))
freq={}
for i in range(m):
for j in range(n):
if b[i]%a[j]==0:
if b[i]//a[j] in freq:
freq[b[i]//a[j]]+=1
else:
freq[b[i]//a[j]]=1
res=0
print(max(freq.values()))
``` | 0 |
|
979 | A | Pizza, Pizza, Pizza!!! | PROGRAMMING | 1,000 | [
"math"
] | null | null | Katie, Kuro and Shiro are best friends. They have known each other since kindergarten. That's why they often share everything with each other and work together on some very hard problems.
Today is Shiro's birthday. She really loves pizza so she wants to invite her friends to the pizza restaurant near her house to celebrate her birthday, including her best friends Katie and Kuro.
She has ordered a very big round pizza, in order to serve her many friends. Exactly $n$ of Shiro's friends are here. That's why she has to divide the pizza into $n + 1$ slices (Shiro also needs to eat). She wants the slices to be exactly the same size and shape. If not, some of her friends will get mad and go home early, and the party will be over.
Shiro is now hungry. She wants to cut the pizza with minimum of straight cuts. A cut is a straight segment, it might have ends inside or outside the pizza. But she is too lazy to pick up the calculator.
As usual, she will ask Katie and Kuro for help. But they haven't come yet. Could you help Shiro with this problem? | A single line contains one non-negative integer $n$ ($0 \le n \leq 10^{18}$) — the number of Shiro's friends. The circular pizza has to be sliced into $n + 1$ pieces. | A single integer — the number of straight cuts Shiro needs. | [
"3\n",
"4\n"
] | [
"2",
"5"
] | To cut the round pizza into quarters one has to make two cuts through the center with angle $90^{\circ}$ between them.
To cut the round pizza into five equal parts one has to make five cuts. | 500 | [
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "5"
},
{
"input": "10",
"output": "11"
},
{
"input": "10000000000",
"output": "10000000001"
},
{
"input": "1234567891",
"output": "617283946"
},
{
"input": "7509213957",
"output": "3754606979"
},
{
"input": "99999999999999999",
"output": "50000000000000000"
},
{
"input": "21",
"output": "11"
},
{
"input": "712394453192",
"output": "712394453193"
},
{
"input": "172212168",
"output": "172212169"
},
{
"input": "822981260158260519",
"output": "411490630079130260"
},
{
"input": "28316250877914571",
"output": "14158125438957286"
},
{
"input": "779547116602436424",
"output": "779547116602436425"
},
{
"input": "578223540024979436",
"output": "578223540024979437"
},
{
"input": "335408917861648766",
"output": "335408917861648767"
},
{
"input": "74859962623690078",
"output": "74859962623690079"
},
{
"input": "252509054433933439",
"output": "126254527216966720"
},
{
"input": "760713016476190622",
"output": "760713016476190623"
},
{
"input": "919845426262703496",
"output": "919845426262703497"
},
{
"input": "585335723211047194",
"output": "585335723211047195"
},
{
"input": "522842184971407769",
"output": "261421092485703885"
},
{
"input": "148049062628894320",
"output": "148049062628894321"
},
{
"input": "84324828731963974",
"output": "84324828731963975"
},
{
"input": "354979173822804781",
"output": "177489586911402391"
},
{
"input": "1312150450968413",
"output": "656075225484207"
},
{
"input": "269587449430302150",
"output": "269587449430302151"
},
{
"input": "645762258982631926",
"output": "645762258982631927"
},
{
"input": "615812229161735895",
"output": "307906114580867948"
},
{
"input": "0",
"output": "0"
},
{
"input": "349993004923078531",
"output": "174996502461539266"
},
{
"input": "891351282707723851",
"output": "445675641353861926"
},
{
"input": "563324731189330734",
"output": "563324731189330735"
},
{
"input": "520974001910286909",
"output": "260487000955143455"
},
{
"input": "666729339802329204",
"output": "666729339802329205"
},
{
"input": "856674611404539671",
"output": "428337305702269836"
},
{
"input": "791809296303238499",
"output": "395904648151619250"
},
{
"input": "711066337317063338",
"output": "711066337317063339"
},
{
"input": "931356503492686566",
"output": "931356503492686567"
},
{
"input": "234122432773361866",
"output": "234122432773361867"
},
{
"input": "1000000000000000000",
"output": "1000000000000000001"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "3"
},
{
"input": "7",
"output": "4"
},
{
"input": "63",
"output": "32"
},
{
"input": "24",
"output": "25"
},
{
"input": "8",
"output": "9"
},
{
"input": "15",
"output": "8"
}
] | 1,527,334,199 | 599 | Python 3 | OK | TESTS | 47 | 93 | 0 | n = int(input())
n+=1
if(n==1):
ans = 0
elif(n%2==0):
ans = n//2
else:
ans = n
print(ans) | Title: Pizza, Pizza, Pizza!!!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Katie, Kuro and Shiro are best friends. They have known each other since kindergarten. That's why they often share everything with each other and work together on some very hard problems.
Today is Shiro's birthday. She really loves pizza so she wants to invite her friends to the pizza restaurant near her house to celebrate her birthday, including her best friends Katie and Kuro.
She has ordered a very big round pizza, in order to serve her many friends. Exactly $n$ of Shiro's friends are here. That's why she has to divide the pizza into $n + 1$ slices (Shiro also needs to eat). She wants the slices to be exactly the same size and shape. If not, some of her friends will get mad and go home early, and the party will be over.
Shiro is now hungry. She wants to cut the pizza with minimum of straight cuts. A cut is a straight segment, it might have ends inside or outside the pizza. But she is too lazy to pick up the calculator.
As usual, she will ask Katie and Kuro for help. But they haven't come yet. Could you help Shiro with this problem?
Input Specification:
A single line contains one non-negative integer $n$ ($0 \le n \leq 10^{18}$) — the number of Shiro's friends. The circular pizza has to be sliced into $n + 1$ pieces.
Output Specification:
A single integer — the number of straight cuts Shiro needs.
Demo Input:
['3\n', '4\n']
Demo Output:
['2', '5']
Note:
To cut the round pizza into quarters one has to make two cuts through the center with angle $90^{\circ}$ between them.
To cut the round pizza into five equal parts one has to make five cuts. | ```python
n = int(input())
n+=1
if(n==1):
ans = 0
elif(n%2==0):
ans = n//2
else:
ans = n
print(ans)
``` | 3 |
|
221 | A | Little Elephant and Function | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | null | null | The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order. | A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation. | In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists. | [
"1\n",
"2\n"
] | [
"1 ",
"2 1 "
] | none | 500 | [
{
"input": "1",
"output": "1 "
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "4",
"output": "4 1 2 3 "
},
{
"input": "5",
"output": "5 1 2 3 4 "
},
{
"input": "6",
"output": "6 1 2 3 4 5 "
},
{
"input": "7",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "999",
"output": "999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "998",
"output": "998 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "997",
"output": "997 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "900",
"output": "900 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "101",
"output": "101 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "67",
"output": "67 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 "
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "971",
"output": "971 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "683",
"output": "683 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "99",
"output": "99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 "
},
{
"input": "811",
"output": "811 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "875",
"output": "875 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "291",
"output": "291 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "419",
"output": "419 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "21",
"output": "21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 "
},
{
"input": "22",
"output": "22 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "23",
"output": "23 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "24",
"output": "24 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 "
},
{
"input": "25",
"output": "25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 "
}
] | 1,618,737,125 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 154 | 0 | try:
n = int(input())
for i in range(n,0,-1):
print(i,end=" ")
except:
pass | Title: Little Elephant and Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
Input Specification:
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
Output Specification:
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists.
Demo Input:
['1\n', '2\n']
Demo Output:
['1 ', '2 1 ']
Note:
none | ```python
try:
n = int(input())
for i in range(n,0,-1):
print(i,end=" ")
except:
pass
``` | 0 |
|
714 | B | Filya and Homework | PROGRAMMING | 1,200 | [
"implementation",
"sortings"
] | null | null | Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal. | The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array. | If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes). | [
"5\n1 3 3 2 1\n",
"5\n1 2 3 4 5\n"
] | [
"YES\n",
"NO\n"
] | In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements. | 1,000 | [
{
"input": "5\n1 3 3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5",
"output": "NO"
},
{
"input": "2\n1 2",
"output": "YES"
},
{
"input": "3\n1 2 3",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "YES"
},
{
"input": "2\n1 1000000000",
"output": "YES"
},
{
"input": "4\n1 2 3 4",
"output": "NO"
},
{
"input": "10\n1 1 1 1 1 2 2 2 2 2",
"output": "YES"
},
{
"input": "2\n4 2",
"output": "YES"
},
{
"input": "4\n1 1 4 7",
"output": "YES"
},
{
"input": "3\n99999999 1 50000000",
"output": "YES"
},
{
"input": "1\n0",
"output": "YES"
},
{
"input": "5\n0 0 0 0 0",
"output": "YES"
},
{
"input": "4\n4 2 2 1",
"output": "NO"
},
{
"input": "3\n1 4 2",
"output": "NO"
},
{
"input": "3\n1 4 100",
"output": "NO"
},
{
"input": "3\n2 5 11",
"output": "NO"
},
{
"input": "3\n1 4 6",
"output": "NO"
},
{
"input": "3\n1 2 4",
"output": "NO"
},
{
"input": "3\n1 2 7",
"output": "NO"
},
{
"input": "5\n1 1 1 4 5",
"output": "NO"
},
{
"input": "2\n100000001 100000003",
"output": "YES"
},
{
"input": "3\n7 4 5",
"output": "NO"
},
{
"input": "3\n2 3 5",
"output": "NO"
},
{
"input": "3\n1 2 5",
"output": "NO"
},
{
"input": "2\n2 3",
"output": "YES"
},
{
"input": "3\n2 100 29",
"output": "NO"
},
{
"input": "3\n0 1 5",
"output": "NO"
},
{
"input": "3\n1 3 6",
"output": "NO"
},
{
"input": "3\n2 1 3",
"output": "YES"
},
{
"input": "3\n1 5 100",
"output": "NO"
},
{
"input": "3\n1 4 8",
"output": "NO"
},
{
"input": "3\n1 7 10",
"output": "NO"
},
{
"input": "3\n5 4 1",
"output": "NO"
},
{
"input": "3\n1 6 10",
"output": "NO"
},
{
"input": "4\n1 3 4 5",
"output": "NO"
},
{
"input": "3\n1 5 4",
"output": "NO"
},
{
"input": "5\n1 2 3 3 5",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "YES"
},
{
"input": "3\n2 3 8",
"output": "NO"
},
{
"input": "3\n0 3 5",
"output": "NO"
},
{
"input": "3\n1 5 10",
"output": "NO"
},
{
"input": "3\n1 7 2",
"output": "NO"
},
{
"input": "3\n1 3 9",
"output": "NO"
},
{
"input": "3\n1 1 2",
"output": "YES"
},
{
"input": "7\n1 1 1 1 1 2 4",
"output": "NO"
},
{
"input": "5\n1 4 4 4 6",
"output": "NO"
},
{
"input": "5\n1 2 2 4 4",
"output": "NO"
},
{
"input": "3\n1 9 10",
"output": "NO"
},
{
"input": "8\n1 1 1 1 1 1 2 3",
"output": "YES"
},
{
"input": "3\n1 2 100",
"output": "NO"
},
{
"input": "3\n1 3 4",
"output": "NO"
},
{
"input": "3\n1 15 14",
"output": "NO"
},
{
"input": "3\n1 3 8",
"output": "NO"
},
{
"input": "3\n1 2 10",
"output": "NO"
},
{
"input": "4\n2 2 4 5",
"output": "NO"
},
{
"input": "3\n1 3 5",
"output": "YES"
},
{
"input": "5\n3 6 7 8 9",
"output": "NO"
},
{
"input": "3\n7 6 8",
"output": "YES"
},
{
"input": "3\n3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 2 2 3",
"output": "YES"
},
{
"input": "3\n4 6 7",
"output": "NO"
},
{
"input": "3\n2 0 4",
"output": "YES"
},
{
"input": "4\n10 20 21 30",
"output": "NO"
},
{
"input": "4\n0 2 3 4",
"output": "NO"
},
{
"input": "3\n3 6 12",
"output": "NO"
},
{
"input": "5\n0 0 1 3 5",
"output": "NO"
},
{
"input": "3\n3 5 8",
"output": "NO"
},
{
"input": "3\n1 4 4",
"output": "YES"
},
{
"input": "4\n2 4 5 6",
"output": "NO"
}
] | 1,483,257,428 | 2,147,483,647 | Python 3 | OK | TESTS | 79 | 109 | 13,619,200 | # print("Input n")
n = int(input())
# print("Input the elements")
a = [int(x) for x in input().split()]
s = set()
for x in a:
s.add(x)
thelist = list(s)
if len(thelist) == 1 or len(thelist) == 2:
print("YES")
elif len(thelist) > 3:
print("NO")
else:
a = min(thelist)
c = max(thelist)
b = sum(thelist) - a - c
if (a+c)/2 == b:
print("YES")
else:
print("NO")
| Title: Filya and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array.
Output Specification:
If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes).
Demo Input:
['5\n1 3 3 2 1\n', '5\n1 2 3 4 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements. | ```python
# print("Input n")
n = int(input())
# print("Input the elements")
a = [int(x) for x in input().split()]
s = set()
for x in a:
s.add(x)
thelist = list(s)
if len(thelist) == 1 or len(thelist) == 2:
print("YES")
elif len(thelist) > 3:
print("NO")
else:
a = min(thelist)
c = max(thelist)
b = sum(thelist) - a - c
if (a+c)/2 == b:
print("YES")
else:
print("NO")
``` | 3 |
|
331 | C1 | The Great Julya Calendar | PROGRAMMING | 1,100 | [
"dp"
] | null | null | Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero. | The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3). | Print a single integer — the minimum number of subtractions that turns the magic number to a zero. | [
"24\n"
] | [
"5"
] | In the first test sample the minimum number of operations can be reached by the following sequence of subtractions: | 20 | [
{
"input": "24",
"output": "5"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "10",
"output": "2"
},
{
"input": "31",
"output": "6"
},
{
"input": "701",
"output": "116"
},
{
"input": "222",
"output": "39"
},
{
"input": "156",
"output": "28"
},
{
"input": "12343",
"output": "1778"
},
{
"input": "7984",
"output": "1178"
},
{
"input": "1000000",
"output": "128207"
},
{
"input": "1",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "1"
},
{
"input": "11",
"output": "3"
},
{
"input": "77",
"output": "14"
},
{
"input": "216",
"output": "37"
},
{
"input": "1468",
"output": "233"
},
{
"input": "1995",
"output": "305"
},
{
"input": "11010",
"output": "1568"
},
{
"input": "47320",
"output": "6746"
},
{
"input": "258634",
"output": "35024"
}
] | 1,637,156,069 | 2,147,483,647 | Python 3 | OK | TESTS1 | 24 | 404 | 0 | n=int(input())
cnt=0
while n!=0:
x=n
n=list(str(n))
x=x-int(max(n))
n=x
cnt+=1
print(cnt) | Title: The Great Julya Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yet another Armageddon is coming! This time the culprit is the Julya tribe calendar.
The beavers in this tribe knew math very well. Smart Beaver, an archaeologist, got a sacred plate with a magic integer on it. The translation from Old Beaverish is as follows:
"May the Great Beaver bless you! May your chacres open and may your third eye never turn blind from beholding the Truth! Take the magic number, subtract a digit from it (the digit must occur in the number) and get a new magic number. Repeat this operation until a magic number equals zero. The Earth will stand on Three Beavers for the time, equal to the number of subtractions you perform!"
Distinct subtraction sequences can obviously get you different number of operations. But the Smart Beaver is ready to face the worst and is asking you to count the minimum number of operations he needs to reduce the magic number to zero.
Input Specification:
The single line contains the magic integer *n*, 0<=≤<=*n*.
- to get 20 points, you need to solve the problem with constraints: *n*<=≤<=106 (subproblem C1); - to get 40 points, you need to solve the problem with constraints: *n*<=≤<=1012 (subproblems C1+C2); - to get 100 points, you need to solve the problem with constraints: *n*<=≤<=1018 (subproblems C1+C2+C3).
Output Specification:
Print a single integer — the minimum number of subtractions that turns the magic number to a zero.
Demo Input:
['24\n']
Demo Output:
['5']
Note:
In the first test sample the minimum number of operations can be reached by the following sequence of subtractions: | ```python
n=int(input())
cnt=0
while n!=0:
x=n
n=list(str(n))
x=x-int(max(n))
n=x
cnt+=1
print(cnt)
``` | 3 |
|
94 | A | Restoring Password | PROGRAMMING | 900 | [
"implementation",
"strings"
] | A. Restoring Password | 2 | 256 | Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification. | The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9. | Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists. | [
"01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n",
"10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n"
] | [
"12345678\n",
"30234919\n"
] | none | 500 | [
{
"input": "01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110",
"output": "12345678"
},
{
"input": "10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000",
"output": "30234919"
},
{
"input": "00010101101110110101100110101100010101100010101111000101011010011010110010000011\n0101010110\n0001001101\n1001101011\n0000100011\n0010101111\n1110110101\n0001010110\n0110111000\n0000111110\n0010000011",
"output": "65264629"
},
{
"input": "10100100010010010011011001101000100100110110011010011001101011000100110110011010\n1111110011\n1001000111\n1001000100\n1100010011\n0110011010\n0010000001\n1110101110\n0010000110\n0010010011\n1010010001",
"output": "98484434"
},
{
"input": "00101100011111010001001000000110110000000110010011001111111010110010001011000000\n0010000001\n0110010011\n0010000010\n1011001000\n0011111110\n0110001000\n1111010001\n1011000000\n0000100110\n0010110001",
"output": "96071437"
},
{
"input": "10001110111110000001000010001010001110110000100010100010111101101101010000100010\n0000010110\n1101010111\n1000101111\n0001011110\n0011110101\n0101100100\n0110110101\n0000100010\n1000111011\n1110000001",
"output": "89787267"
},
{
"input": "10010100011001010001010101001101010100110100111011001010111100011001000010100000\n0011100000\n1001100100\n0001100100\n0010100000\n0101010011\n0010101110\n0010101111\n0100111011\n1001010001\n1111111110",
"output": "88447623"
},
{
"input": "01101100111000000101011011001110000001011111111000111111100001011010001001011001\n1000000101\n0101101000\n0101110101\n1101011110\n0000101100\n1111111000\n0001001101\n0110111011\n0110110011\n1001011001",
"output": "80805519"
},
{
"input": "11100011000100010110010011101010101010011110001100011010111110011000011010110111\n1110001100\n0110101111\n0100111010\n0101000000\n1001100001\n1010101001\n0000100010\n1010110111\n1100011100\n0100010110",
"output": "09250147"
},
{
"input": "10000110110000010100000010001000111101110110101011110111000100001101000000100010\n0000010100\n0000110001\n0110101011\n1101110001\n1000011011\n0000110100\n0011110111\n1000110010\n0000100010\n0000011011",
"output": "40862358"
},
{
"input": "01000000010000000110100101000110110000100100000001101100001000011111111001010001\n1011000010\n1111101010\n0111110011\n0000000110\n0000001001\n0001111111\n0110010010\n0100000001\n1011001000\n1001010001",
"output": "73907059"
},
{
"input": "01111000111110011001110101110011110000111110010001101100110110100111101011001101\n1110010001\n1001100000\n1100001000\n1010011110\n1011001101\n0111100011\n1101011100\n1110011001\n1111000011\n0010000101",
"output": "57680434"
},
{
"input": "01001100101000100010001011110001000101001001100010010000001001001100101001011111\n1001011111\n1110010111\n0111101011\n1000100010\n0011100101\n0100000010\n0010111100\n0100010100\n1001100010\n0100110010",
"output": "93678590"
},
{
"input": "01110111110000111011101010110110101011010100110111000011101101110101011101001000\n0110000101\n1010101101\n1101010111\n1101011100\n0100110111\n0111011111\n1100011001\n0111010101\n0000111011\n1101001000",
"output": "58114879"
},
{
"input": "11101001111100110101110011010100110011011110100111010110110011000111000011001101\n1100011100\n1100110101\n1011101000\n0011011110\n0011001101\n0100010001\n1110100111\n1010101100\n1110110100\n0101101100",
"output": "61146904"
},
{
"input": "10101010001011010001001001011000100101100001011011101010101110101010001010101000\n0010110101\n1010011010\n1010101000\n1011010001\n1010101011\n0010010110\n0110100010\n1010100101\n0001011011\n0110100001",
"output": "23558422"
},
{
"input": "11110101001100010000110100001110101011011111010100110001000001001010001001101111\n0101101100\n1001101111\n1010101101\n0100101000\n1111110000\n0101010010\n1100010000\n1111010100\n1101000011\n1011111111",
"output": "76827631"
},
{
"input": "10001100110000110111100011001101111110110011110101000011011100001101110000110111\n0011110101\n0101100011\n1000110011\n1011011001\n0111111011\n0101111011\n0000110111\n0100001110\n1000000111\n0110110111",
"output": "26240666"
},
{
"input": "10000100010000111101100100111101111011101000001001100001000110000010010000111101\n1001001111\n0000111101\n1000010001\n0110011101\n0110101000\n1011111001\n0111101110\n1000001001\n1101011111\n0001010100",
"output": "21067271"
},
{
"input": "01101111000110111100011011110001101111001010001100101000110001010101100100000010\n1010001100\n0011010011\n0101010110\n1111001100\n1100011000\n0100101100\n1001100101\n0110111100\n0011001101\n0100000010",
"output": "77770029"
},
{
"input": "10100111011010001011111000000111100000010101000011000010111101010000111010011101\n1010011101\n1010111111\n0110100110\n1111000100\n1110000001\n0000101111\n0011111000\n1000110001\n0101000011\n1010001011",
"output": "09448580"
},
{
"input": "10000111111000011111001010101010010011111001001111000010010100100011000010001100\n1101101110\n1001001111\n0000100101\n1100111010\n0010101010\n1110000110\n1100111101\n0010001100\n1110000001\n1000011111",
"output": "99411277"
},
{
"input": "10110110111011001111101100111100111111011011011011001111110110010011100010000111\n0111010011\n0111101100\n1001101010\n0101000101\n0010000111\n0011111101\n1011001111\n1101111000\n1011011011\n1001001110",
"output": "86658594"
},
{
"input": "01001001100101100011110110111100000110001111001000100000110111110010000000011000\n0100100110\n1000001011\n1000111110\n0000011000\n0101100011\n1101101111\n1111001000\n1011011001\n1000001101\n0010101000",
"output": "04536863"
},
{
"input": "10010100011101000011100100001100101111000010111100000010010000001001001101011101\n1001000011\n1101000011\n1001010001\n1101011101\n1000010110\n0011111101\n0010111100\n0000100100\n1010001000\n0101000110",
"output": "21066773"
},
{
"input": "01111111110101111111011111111111010010000001100000101000100100111001011010001001\n0111111111\n0101111111\n0100101101\n0001100000\n0011000101\n0011100101\n1101001000\n0010111110\n1010001001\n1111000111",
"output": "01063858"
},
{
"input": "00100011111001001010001111000011101000001110100000000100101011101000001001001010\n0010001111\n1001001010\n1010011001\n0011100111\n1000111000\n0011110000\n0000100010\n0001001010\n1111110111\n1110100000",
"output": "01599791"
},
{
"input": "11011101000100110100110011010101100011111010011010010011010010010010100110101111\n0100110100\n1001001010\n0001111101\n1101011010\n1101110100\n1100110101\n0110101111\n0110001111\n0001101000\n1010011010",
"output": "40579016"
},
{
"input": "10000010111101110110011000111110000011100110001111100100000111000011011000001011\n0111010100\n1010110110\n1000001110\n1110000100\n0110001111\n1101110110\n1100001101\n1000001011\n0000000101\n1001000001",
"output": "75424967"
},
{
"input": "11101100101110111110111011111010001111111111000001001001000010001111111110110010\n0101100001\n1111010011\n1110111110\n0100110100\n1110011111\n1000111111\n0010010000\n1110110010\n0011000010\n1111000001",
"output": "72259657"
},
{
"input": "01011110100101111010011000001001100000101001110011010111101011010000110110010101\n0100111100\n0101110011\n0101111010\n0110000010\n0101001111\n1101000011\n0110010101\n0111011010\n0001101110\n1001110011",
"output": "22339256"
},
{
"input": "01100000100101111000100001100010000110000010100100100001100000110011101001110000\n0101111000\n1001110000\n0001000101\n0110110111\n0010100100\n1000011000\n1101110110\n0110000010\n0001011010\n0011001110",
"output": "70554591"
},
{
"input": "11110011011000001001111100110101001000010100100000110011001110011111100100100001\n1010011000\n1111001101\n0100100001\n1111010011\n0100100000\n1001111110\n1010100111\n1000100111\n1000001001\n1100110011",
"output": "18124952"
},
{
"input": "10001001011000100101010110011101011001110010000001010110000101000100101111101010\n0101100001\n1100001100\n1111101010\n1000100101\n0010000001\n0100010010\n0010110110\n0101100111\n0000001110\n1101001110",
"output": "33774052"
},
{
"input": "00110010000111001001001100100010010111101011011110001011111100000101000100000001\n0100000001\n1011011110\n0010111111\n0111100111\n0100111001\n0000010100\n1001011110\n0111001001\n0100010011\n0011001000",
"output": "97961250"
},
{
"input": "01101100001000110101101100101111101110010011010111100011010100010001101000110101\n1001101001\n1000110101\n0110110000\n0111100100\n0011010111\n1110111001\n0001000110\n0000000100\n0001101001\n1011001011",
"output": "21954161"
},
{
"input": "10101110000011010110101011100000101101000110100000101101101101110101000011110010\n0110100000\n1011011011\n0011110010\n0001110110\n0010110100\n1100010010\n0001101011\n1010111000\n0011010110\n0111010100",
"output": "78740192"
},
{
"input": "11000101011100100111010000010001000001001100101100000011000000001100000101011010\n1100010101\n1111101011\n0101011010\n0100000100\n1000110111\n1100100111\n1100101100\n0111001000\n0000110000\n0110011111",
"output": "05336882"
},
{
"input": "11110100010000101110010110001000001011100101100010110011011011111110001100110110\n0101100010\n0100010001\n0000101110\n1100110110\n0101000101\n0011001011\n1111010001\n1000110010\n1111111000\n1010011111",
"output": "62020383"
},
{
"input": "00011001111110000011101011010001010111100110100101000110011111011001100000001100\n0111001101\n0101011110\n0001100111\n1101011111\n1110000011\n0000001100\n0111010001\n1101100110\n1010110100\n0110100101",
"output": "24819275"
},
{
"input": "10111110010011111001001111100101010111010011111001001110101000111110011001111101\n0011111001\n0101011101\n0100001010\n0001110010\n1001111101\n0011101010\n1111001001\n1100100001\n1001101000\n1011111001",
"output": "90010504"
},
{
"input": "01111101111100101010001001011110111001110111110111011111011110110111111011011111\n1111110111\n0010000101\n0110000100\n0111111011\n1011100111\n1100101010\n1011011111\n1100010001\n0111110111\n0010010111",
"output": "85948866"
},
{
"input": "01111100000111110000110010111001111100001001101010110010111010001000101001101010\n0100010101\n1011110101\n1010100100\n1010000001\n1001101010\n0101100110\n1000100010\n0111110000\n1100101110\n0110010110",
"output": "77874864"
},
{
"input": "11100011010000000010011110010111001011111001000111000000001000000000100111100101\n0000000010\n1110001101\n0011010101\n0111100101\n1001000111\n1101001111\n0111010110\n1100101111\n0110000000\n1101101011",
"output": "10374003"
},
{
"input": "01111011100111101110011001000110001111101000111110100100100001011111001011100010\n0110010100\n1100010001\n0111101110\n1001001000\n1010011011\n1000111110\n0010110101\n1011100010\n0101111100\n0110010001",
"output": "22955387"
},
{
"input": "11011010001100000011000100110011010101000110011110110000001100111100001000011111\n0000100010\n1000011111\n1101101000\n0110011110\n0011110000\n1100000011\n0010001100\n0101101000\n0001001100\n1101010100",
"output": "25893541"
},
{
"input": "01011001011111010010101111011001000011001100011101101111011011010011101011110110\n0100001100\n0101100101\n1111111011\n1111010010\n1111101100\n1100011101\n1011000011\n1101001110\n1011110110\n0110001010",
"output": "13805878"
},
{
"input": "11110011011000111111001100111110001111111100000010111100110100110011111111001101\n1111001101\n1001101010\n1100110010\n0011001111\n0001011110\n1000110011\n1000111111\n0110001010\n1001011101\n1100000010",
"output": "06369030"
},
{
"input": "01110011110010000011011001011000001000010110010110011001100001100110001100101000\n0000100001\n0110011000\n1010000010\n1110011101\n0111001111\n1100101000\n0010000011\n0110010000\n1100100101\n0110010110",
"output": "46909115"
},
{
"input": "00001011001111110111111111011111111101110101110100010111010010100101100001010110\n1111110111\n0001010110\n0111011011\n0111000001\n1010010110\n0101110100\n0001000101\n0000111000\n0110100001\n0000101100",
"output": "90005541"
}
] | 1,584,688,849 | 2,147,483,647 | PyPy 3 | OK | TESTS | 50 | 310 | 0 | #!/usr/bin/python3
s, ma = input(), {}
[ma.update({input(): i}) for i in range(10)]
[print(ma[s[i:(i+10)]], end='') for i in range(0, len(s), 10)]
| Title: Restoring Password
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Igor K. always used to trust his favorite Kashpirovsky Antivirus. That is why he didn't hesitate to download the link one of his groupmates sent him via QIP Infinium. The link was said to contain "some real funny stuff about swine influenza". The antivirus had no objections and Igor K. run the flash application he had downloaded. Immediately his QIP Infinium said: "invalid login/password".
Igor K. entered the ISQ from his additional account and looked at the info of his main one. His name and surname changed to "H1N1" and "Infected" correspondingly, and the "Additional Information" field contained a strange-looking binary code 80 characters in length, consisting of zeroes and ones. "I've been hacked" — thought Igor K. and run the Internet Exploiter browser to quickly type his favourite search engine's address.
Soon he learned that it really was a virus that changed ISQ users' passwords. Fortunately, he soon found out that the binary code was actually the encrypted password where each group of 10 characters stood for one decimal digit. Accordingly, the original password consisted of 8 decimal digits.
Help Igor K. restore his ISQ account by the encrypted password and encryption specification.
Input Specification:
The input data contains 11 lines. The first line represents the binary code 80 characters in length. That is the code written in Igor K.'s ISQ account's info. Next 10 lines contain pairwise distinct binary codes 10 characters in length, corresponding to numbers 0, 1, ..., 9.
Output Specification:
Print one line containing 8 characters — The password to Igor K.'s ISQ account. It is guaranteed that the solution exists.
Demo Input:
['01001100100101100000010110001001011001000101100110010110100001011010100101101100\n0100110000\n0100110010\n0101100000\n0101100010\n0101100100\n0101100110\n0101101000\n0101101010\n0101101100\n0101101110\n', '10101101111001000010100100011010101101110010110111011000100011011110010110001000\n1001000010\n1101111001\n1001000110\n1010110111\n0010110111\n1101001101\n1011000001\n1110010101\n1011011000\n0110001000\n']
Demo Output:
['12345678\n', '30234919\n']
Note:
none | ```python
#!/usr/bin/python3
s, ma = input(), {}
[ma.update({input(): i}) for i in range(10)]
[print(ma[s[i:(i+10)]], end='') for i in range(0, len(s), 10)]
``` | 3.9225 |
369 | C | Valera and Elections | PROGRAMMING | 1,600 | [
"dfs and similar",
"graphs",
"trees"
] | null | null | The city Valera lives in is going to hold elections to the city Parliament.
The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired.
There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located.
Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city.
Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road.
It's guaranteed that the graph structure of the city is a tree. | In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them. | [
"5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n",
"5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n",
"5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n"
] | [
"1\n5 \n",
"1\n3 \n",
"4\n5 4 3 2 \n"
] | none | 1,500 | [
{
"input": "5\n1 2 2\n2 3 2\n3 4 2\n4 5 2",
"output": "1\n5 "
},
{
"input": "5\n1 2 1\n2 3 2\n2 4 1\n4 5 1",
"output": "1\n3 "
},
{
"input": "5\n1 2 2\n1 3 2\n1 4 2\n1 5 2",
"output": "4\n5 4 3 2 "
},
{
"input": "5\n1 5 1\n5 4 2\n4 3 1\n3 2 2",
"output": "1\n2 "
},
{
"input": "2\n1 2 1",
"output": "0"
},
{
"input": "10\n7 5 1\n2 1 2\n8 7 2\n2 4 1\n4 5 2\n9 5 1\n3 2 2\n2 10 1\n6 5 2",
"output": "3\n8 6 3 "
},
{
"input": "2\n2 1 1",
"output": "0"
},
{
"input": "2\n1 2 2",
"output": "1\n2 "
},
{
"input": "5\n3 1 1\n4 5 1\n1 4 1\n1 2 1",
"output": "0"
},
{
"input": "5\n1 3 2\n5 4 2\n2 1 2\n4 3 2",
"output": "2\n5 2 "
},
{
"input": "10\n1 9 1\n3 2 2\n1 2 2\n4 7 2\n3 5 2\n4 3 2\n10 3 2\n7 8 2\n3 6 1",
"output": "3\n8 10 5 "
},
{
"input": "10\n7 9 2\n2 6 2\n7 4 1\n5 4 2\n3 2 1\n8 5 2\n4 3 2\n7 10 1\n1 2 2",
"output": "3\n9 8 6 "
},
{
"input": "10\n3 9 1\n2 10 2\n1 7 1\n3 4 1\n7 8 2\n1 2 1\n5 3 1\n5 6 2\n2 3 2",
"output": "3\n6 10 8 "
},
{
"input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 1\n7 5 1\n6 4 1\n5 3 1\n4 2 1",
"output": "2\n7 8 "
},
{
"input": "10\n1 10 2\n10 9 2\n10 8 2\n9 7 2\n8 6 2\n7 5 2\n6 4 2\n5 3 2\n4 2 2",
"output": "2\n3 2 "
},
{
"input": "4\n1 2 2\n2 3 1\n2 4 2",
"output": "1\n4 "
}
] | 1,585,806,203 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 5 | 374 | 25,292,800 | from bisect import bisect_left as bl, bisect_right as br, insort
import sys
import heapq
from math import *
from collections import defaultdict as dd, deque
def data(): return sys.stdin.readline().strip()
def mdata(): return map(int, data().split())
sys.setrecursionlimit(100000)
S=set()
def dfs(x):
flag=False
for i in g[x]:
if i!=par[x]:
par[i]=x
if dfs(i):
flag=True
if flag==True:
return True
if g[par[x]].get(x)==2:
S.add(x)
return True
return False
n=int(data())
g=dd(dict)
for i in range(n-1):
a,b,c=mdata()
g[a][b]=c
g[b][a]=c
par=[0]*(n+1)
dfs(1)
S=list(S)
print(len(S))
print(*S) | Title: Valera and Elections
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The city Valera lives in is going to hold elections to the city Parliament.
The city has *n* districts and *n*<=-<=1 bidirectional roads. We know that from any district there is a path along the roads to any other district. Let's enumerate all districts in some way by integers from 1 to *n*, inclusive. Furthermore, for each road the residents decided if it is the problem road or not. A problem road is a road that needs to be repaired.
There are *n* candidates running the elections. Let's enumerate all candidates in some way by integers from 1 to *n*, inclusive. If the candidate number *i* will be elected in the city Parliament, he will perform exactly one promise — to repair all problem roads on the way from the *i*-th district to the district 1, where the city Parliament is located.
Help Valera and determine the subset of candidates such that if all candidates from the subset will be elected to the city Parliament, all problem roads in the city will be repaired. If there are several such subsets, you should choose the subset consisting of the minimum number of candidates.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the number of districts in the city.
Then *n*<=-<=1 lines follow. Each line contains the description of a city road as three positive integers *x**i*, *y**i*, *t**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, 1<=≤<=*t**i*<=≤<=2) — the districts connected by the *i*-th bidirectional road and the road type. If *t**i* equals to one, then the *i*-th road isn't the problem road; if *t**i* equals to two, then the *i*-th road is the problem road.
It's guaranteed that the graph structure of the city is a tree.
Output Specification:
In the first line print a single non-negative number *k* — the minimum size of the required subset of candidates. Then on the second line print *k* space-separated integers *a*1,<=*a*2,<=... *a**k* — the numbers of the candidates that form the required subset. If there are multiple solutions, you are allowed to print any of them.
Demo Input:
['5\n1 2 2\n2 3 2\n3 4 2\n4 5 2\n', '5\n1 2 1\n2 3 2\n2 4 1\n4 5 1\n', '5\n1 2 2\n1 3 2\n1 4 2\n1 5 2\n']
Demo Output:
['1\n5 \n', '1\n3 \n', '4\n5 4 3 2 \n']
Note:
none | ```python
from bisect import bisect_left as bl, bisect_right as br, insort
import sys
import heapq
from math import *
from collections import defaultdict as dd, deque
def data(): return sys.stdin.readline().strip()
def mdata(): return map(int, data().split())
sys.setrecursionlimit(100000)
S=set()
def dfs(x):
flag=False
for i in g[x]:
if i!=par[x]:
par[i]=x
if dfs(i):
flag=True
if flag==True:
return True
if g[par[x]].get(x)==2:
S.add(x)
return True
return False
n=int(data())
g=dd(dict)
for i in range(n-1):
a,b,c=mdata()
g[a][b]=c
g[b][a]=c
par=[0]*(n+1)
dfs(1)
S=list(S)
print(len(S))
print(*S)
``` | -1 |
Subsets and Splits
No saved queries yet
Save your SQL queries to embed, download, and access them later. Queries will appear here once saved.